Property Summary

NCBI Gene PubMed Count 97
Grant Count 15
R01 Count 8
Funding $2,042,117.4
PubMed Score 117.02
PubTator Score 132.38

Knowledge Summary

Patent (3,613)

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.400 0.000
non-small cell lung cancer -1.531 0.000
interstitial cystitis -2.400 0.000
lung adenocarcinoma -1.200 0.000
primary Sjogren syndrome -1.500 0.005
nasopharyngeal carcinoma 1.900 0.004
lung carcinoma -1.500 0.000

Gene RIF (73)

PMID Text
26437894 Both vascular smooth muscle cell and bronchial gamma-ENaC downregulation may explain pulmonary fluid disturbances and participate in pulmonary edema pathogenesis.
25900089 One nonsynonymous amino acid variants in SCNN1G in nonwhite Cystic fibrosis patients with non-diagnostic CFTR genotypes was identified.
25559464 The transcriptional expression of alpha, beta, and gamma subunits of ENaC was elevated in nasal polyp compared to nasal mucosa
25555911 Data indicate that urokinase-type plasminogen activator (uPA) activates epithelial sodium channel, gamma subunit (ENaC gamma) through catalytic activity-dependent proteolytic modification.
25450293 High serum leptin may reduce endometrial receptivity by activating the STAT3 signal pathway and down-regulating gamma-ENaC expression in the endometrium.
25231509 Suggest that SCNN1G gene has important roles in blood pressure regulation in the Han Chinese population.
25060057 human kidney gammaENaC is subject to proteolytic cleavage, yielding fragments compatible with furin cleavage, and proteinuria is associated with cleavage at the putative prostasin/kallikrein site and removal of the inhibitory tract within gammaENaC
24735600 SCNN1A and SCNN1G SNPs may contribute to blood pressure changes over time in the Han Chinese population.
24692558 gamma subunit palmitoylation has a dominant role over beta subunit palmitoylation in modulating ENaC gating
23594824 WNK4 inhibits ENaC channel activity independently of Nedd4-2-mediated ENaC ubiquitination.
More...

AA Sequence

MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQ      1 - 70
CALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREA     71 - 140
ESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSND    141 - 210
TSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMH    211 - 280
GNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETA    281 - 350
MVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAA    351 - 420
NYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWLLPVLTWDQGR    421 - 490
QVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVFFIDFFSI    491 - 560
IARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDDDLPTFNSALHLPPALGTQVPGTPPPKYNTL    561 - 630
RLERAFSNQLTDTQMLDEL                                                       631 - 649
//

Text Mined References (100)

PMID Year Title
26772908 2016 Epithelial sodium channel (ENaC) family: Phylogeny, structure-function, tissue distribution, and associated inherited diseases.
26437894 2015 A potential role for interleukin-33 and ?-epithelium sodium channel in the pathogenesis of human malaria associated lung injury.
25900089 2016 Assessment of epithelial sodium channel variants in nonwhite cystic fibrosis patients with non-diagnostic CFTR genotypes.
25559464 2015 Expression and distribution of epithelial sodium channel in nasal polyp and nasal mucosa.
25555911 2015 Proteolytic regulation of epithelial sodium channels by urokinase plasminogen activator: cutting edge and cleavage sites.
25450293 2015 Leptin down-regulates ?-ENaC expression: a novel mechanism involved in low endometrial receptivity.
25378078 2015 A novel frameshift mutation of epithelial sodium channel ?-subunit leads to Liddle syndrome in an isolated case.
25231509 2015 Associations of epithelial sodium channel genes with blood pressure: the GenSalt study.
25060057 2015 The epithelial sodium channel ?-subunit is processed proteolytically in human kidney.
24735600 2014 Associations of epithelial sodium channel genes with blood pressure changes and hypertension incidence: the GenSalt study.
More...