Property Summary

Ligand Count 2
NCBI Gene PubMed Count 124
PubMed Score 52.60
PubTator Score 63.56

Knowledge Summary

Patent (2,046)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Kidney disease 430 3.775 1.9

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis -1.300 9.4e-05
ependymoma 1.100 1.2e-03
esophageal adenocarcinoma -2.200 1.9e-02
gastric carcinoma -1.900 2.9e-02
interstitial cystitis -1.900 8.6e-04
lung adenocarcinoma -1.200 1.6e-07
lung carcinoma -1.700 4.5e-19
non-small cell lung cancer -1.445 1.5e-10
osteosarcoma -1.397 4.6e-05
ulcerative colitis -2.000 4.8e-03

Protein-protein Interaction (1)

Gene RIF (88)

AA Sequence

MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIF      1 - 70
IRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNL     71 - 140
NFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTS    141 - 210
ATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMT    211 - 280
EKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDK    281 - 350
LQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF    351 - 420
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRK    421 - 490
GIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAK    491 - 560
SLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDV    561 - 630
IESDSEGDAI                                                                631 - 640
//

Text Mined References (131)

PMID Year Title