Property Summary

Ligand Count 10
NCBI Gene PubMed Count 23
PubMed Score 7.06
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 2.500 2.7e-07

Gene RIF (7)

AA Sequence

MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYT      1 - 70
PDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQE     71 - 140
SFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPREL    141 - 210
GQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYE    211 - 280
GKVEFKLKIEK                                                               281 - 291
//

Text Mined References (23)

PMID Year Title