Property Summary

NCBI Gene PubMed Count 28
Grant Count 17
R01 Count 8
Funding $1,773,776.5
PubMed Score 142.91
PubTator Score 61.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (15)

PMID Text
26613247 Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR
25073073 Analysis of slow and fast motions in I-BABP indicates largely different energy landscapes for the apo and holo states suggesting that optimization of binding interactions might be achieved by altering the dynamic behavior of specific protein segments.
23758264 show, using electrospray ionization mass spectroscopy, that human ILBP binds bile acids with a 3:1 ratio, even at low protein and ligand concentrations
22329738 NMR data are in agreement with a conformational selection model we proposed earlier for I-BABP and support the hypothesis of an allosteric mechanism of ligand binding
22223860 Ursodeoxycholic acid induces unique conformational changes in IBABP.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19744871 The-putative functional-Thr79Met substitution of FABP6 confers a protective effect on type 2 diabetes in obese individuals.
19744871 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17266179 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKES      1 - 70
NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA                 71 - 128
//

Text Mined References (30)

PMID Year Title
26613247 2016 Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR.
25073073 2014 Temperature dependence of backbone dynamics in human ileal bile acid-binding protein: implications for the mechanism of ligand binding.
23758264 2013 Cooperativity and site selectivity in the ileal lipid binding protein.
22329738 2012 Internal motions and exchange processes in human ileal bile acid binding protein as studied by backbone (15)N nuclear magnetic resonance spectroscopy.
22223860 2012 Unusual binding of ursodeoxycholic acid to ileal bile acid binding protein: role in activation of FXR?.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19744871 2009 Evidence for the Thr79Met polymorphism of the ileal fatty acid binding protein (FABP6) to be associated with type 2 diabetes in obese individuals.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17909007 2007 A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma.
More...