Property Summary

NCBI Gene PubMed Count 113
PubMed Score 184.94
PubTator Score 170.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 2.34057185523308E-16
pituitary cancer 1972 7.24294041705224E-9
lung cancer 4473 3.63893574525082E-7
pilocytic astrocytoma 3086 3.90902417787191E-7
osteosarcoma 7933 1.71150880102179E-6
malignant mesothelioma 3163 2.21525165590476E-6
posterior fossa group A ependymoma 1511 6.26815476015944E-6
psoriasis 6685 2.80675121901971E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 7.83574043471638E-5
atypical teratoid / rhabdoid tumor 4369 8.64834952267132E-5
interstitial cystitis 2299 1.52470633350801E-4
ovarian cancer 8492 1.58101651568368E-4
glioblastoma 5572 7.62960503521992E-4
pediatric high grade glioma 2712 0.00123137888565847
primary Sjogren syndrome 789 0.00286223604658188
ductal carcinoma in situ 1745 0.00295068964662031
medulloblastoma, large-cell 6234 0.00362309740774357
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00533352049853064
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0053509851694624
invasive ductal carcinoma 2950 0.00614934794401277
active Crohn's disease 918 0.0063455647058541
cutaneous lupus erythematosus 1056 0.00644634475632372
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00695779682395169
subependymal giant cell astrocytoma 2287 0.00716630878772974
colon cancer 1475 0.0165684174692882
aldosterone-producing adenoma 664 0.0206801225594921
gastric carcinoma 832 0.0346527352576378
active ulcerative colitis 477 0.0415164564802103
Disease Target Count
Griscelli syndrome type 2 1
Disease Target Count
Griscelli syndrome 2 1

Expression

Synonym

Accession P51159 O00195 Q6FI40 Q9UIR9 Q9Y5U3 Rab-27
Symbols GS2
RAM
RAB27
HsT18676

Gene

  Ortholog (11)

Gene RIF (74)

PMID Text
26880764 We report two unrelated teenagers with hemophagocytic lymphohistiocytosis and an identical heterozygous RAB27A mutation (c.259G-->C).
26760980 decreased expression of Rab27A and Rab27B, especially Rab27A, closely correlated with tumor progression and are valuable prognostic indicators in colorectal cancer patients.
26384136 Data suggest that microRNA miR-582-5p may function as a tumor suppressor in the development of colorectal carcinoma (CRC) by targeting RAS-related GTP-binding protein (Rab27a), indicating a novel therapeutic strategy for patients with CRC.
26305877 miR-122 has a Rab27a-dependent function in the hepatitis C virus lifecycle
26070933 Rab27A may be used as a valuable prognostic biomarker for colorectal carcinoma patients.
25940347 SLP2 is a Rab27a effector required for HIV-1 Gag assembly at the plasma membrane in Jurkat cells
25940347 Silencing of Rab27a by shRNA inhibits HIV-1 replication in CD4+ T-cells and monocyte-derived macrophages
25431337 This study identified a common variant located in RAB27A gene influencing FeNO levels specifically in adults and with a biological relevance to the regulation of FeNO levels.
25428385 Our data indicate that RAB27A expression is an independent prognostic marker for pancreatic ductal adenocarcinoma
25312756 These studies highlight the need for RAB27A sequencing in patients with FHL with normal pigmentation and identify a critical binding site for Munc13-4 on Rab27a, revealing the molecular basis of this interaction.
More...

AA Sequence

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL      1 - 70
QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ     71 - 140
RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL    141 - 210
SEEKEKGACGC                                                               211 - 221
//

Text Mined References (118)

PMID Year Title
26880764 2016 A Heterozygous RAB27A Mutation Associated with Delayed Cytolytic Granule Polarization and Hemophagocytic Lymphohistiocytosis.
26760980 2015 Decreased expression of Rab27A and Rab27B correlates with metastasis and poor prognosis in colorectal cancer.
26384136 2015 Upregulation of miR-582-5p inhibits cell proliferation, cell cycle progression and invasion by targeting Rab27a in human colorectal carcinoma.
26305877 2015 Supporting Role for GTPase Rab27a in Hepatitis C Virus RNA Replication through a Novel miR-122-Mediated Effect.
26070933 2015 High Rab27A expression indicates favorable prognosis in CRC.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25431337 2015 A common variant in RAB27A gene is associated with fractional exhaled nitric oxide levels in adults.
25428385 2015 High expression of RAB27A and TP53 in pancreatic cancer predicts poor survival.
25312756 2015 Patients with Griscelli syndrome and normal pigmentation identify RAB27A mutations that selectively disrupt MUNC13-4 binding.
25261234 2014 Cellular disposal of miR23b by RAB27-dependent exosome release is linked to acquisition of metastatic properties.
More...