Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
R01 Count 2
Funding $73,755
PubMed Score 14.90
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma 1.356 0.001
ovarian cancer -1.600 0.000
chronic rhinosinusitis -1.068 0.025

Synonym

Accession P51157 G8JLC5 Q8IYR8 Q8NI05
Symbols CORD18

Gene

 Grant Application (2)

PDB

2HXS   3E5H  

Gene RIF (6)

PMID Text
25356532 Deleterious mutations in RAB28 result in a classic CRD phenotype and are an infrequent cause of CRD in the Spanish population.
23746546 Autosomal-recessive cone-rod dystrophy is associated with RAB28 mutations.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19026641 Crystal structures of Rab28 in the active (GppNHp-bound) and inactive (GDP-3'P-bound) forms at 1.5 and 1.1A resolution were reported.
18976975 Knockdown of RAB28, member RAS oncogene family (RAB28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of RAB28, member RAS oncogene family (RAB28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIG      1 - 70
GQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIK     71 - 140
PEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTV    141 - 210
NPPRSSMCAVQ                                                               211 - 221
//

Text Mined References (18)

PMID Year Title
25356532 2015 New mutations in the RAB28 gene in 2 Spanish families with cone-rod dystrophy.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23746546 2013 Mutations in RAB28, encoding a farnesylated small GTPase, are associated with autosomal-recessive cone-rod dystrophy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19026641 2008 Large nucleotide-dependent conformational change in Rab28.
17411337 2007 Towards complete sets of farnesylated and geranylgeranylated proteins.
More...