Property Summary

NCBI Gene PubMed Count 34
Grant Count 5
R01 Count 3
Funding $712,483.25
PubMed Score 26.18
PubTator Score 23.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
27044746 the role of Rab13 as a potent driver of cancer progression.
26471730 Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).
25713415 Disruption of Rab13-mediated trafficking dramatically limits the invasive behavior of epithelial cells in vitro and the growth and migration of highly invasive cancer cells in vivo.
22562557 It is suggested that Rab13 is associated with a putative secretory function in osteoclasts.
19885626 Rab13,VASP,and ZO-1 were found in apical tight junctions in normal epithelium but were dislocated to the basolateral position in patients with inactive Crohn's disease. In patients with ulcerative colitis,these tight junction proteins were not dislocated.
18779367 Rab13 regulates membrane trafficking between the trans-Golgi network (TGN) and recycling endosomes (RE).
17891173 Involved in epithelial cell scattering.
15528189 Rab13 specifically mediates the continuous endocytic recycling of occludin to the cell surface in both fibroblastic and epithelial cells

AA Sequence

MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF      1 - 70
KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA     71 - 140
REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG           141 - 203
//

Text Mined References (39)

PMID Year Title
27044746 2016 Regulation of Cancer Cell Behavior by the Small GTPase Rab13.
26471730 2015 Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.
25713415 2015 DENND2B activates Rab13 at the leading edge of migrating cells and promotes metastatic behavior.
23772379 2013 Novel interaction of Rab13 and Rab8 with endospanins.
22562557 2012 Rab13 is upregulated during osteoclast differentiation and associates with small vesicles revealing polarized distribution in resorbing cells.
21795389 2011 MICAL-like1 mediates epidermal growth factor receptor endocytosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...