Property Summary

NCBI Gene PubMed Count 39
Grant Count 1
Funding $30,093.75
PubMed Score 7.48
PubTator Score 49.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.402 0.012
malignant mesothelioma -1.200 0.000
glioblastoma 1.100 0.002
medulloblastoma, large-cell -1.200 0.000
spina bifida -1.505 0.041
ovarian cancer -1.700 0.000

Synonym

Accession P51151 A8K390 Q6ICN1
Symbols RAB9

Gene

 Grant Application (1)

PDB

1WMS  

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
485297 confirmatory 9143 / 10201 / 301951 qHTS Assay for Rab9 Promoter Activators
485316 summary 0 / 0 / 0 qHTS Assay for Rab9 Promoter Activators: Summary
493200 confirmatory 47 / 38 / 137 qHTS Assay for Rab9 Promoter Activators: Initial hit validation from the primary screen
624116 confirmatory 10 / 22 / 190 qHTS Assay for Rab9 Promoter Activators: Hit Validation Using Renilla Luciferase Read-Out for Rab9
624493 confirmatory 43 / 45 / 133 qHTS Assay for Rab9 Promoter Activators: Hit Validation Using Firefly Luciferase Read-Out for NPC1
624501 confirmatory 40 / 44 / 137 qHTS Assay for Rab9 Promoter Activators: Hit Validation Using Firefly Luciferase Read-Out for Rab9
720525 confirmatory 43 / 39 / 139 qHTS Assay for NPC1 Promoter Activators: Hit Validation Using Firefly Luciferase Read-Out for Rab9
720528 confirmatory 13 / 18 / 190 qHTS Assay for NPC1 Promoter Activators: Hit Validation Using Renila Luciferase Read-Out for Rab9

Gene RIF (22)

PMID Text
26527546 Rab9A and its co-regulatory GTPases control STX13-mediated cargo delivery to maturing melanosomes.
24480419 Rab9-complexed TIP47 plays an essential role for the proper release of hepatitis C viral particles.
23345514 Rab9a and Rab7b are mediators of the transit of the L2 capsid protien and the pseudogenome of human papillomavirus 16 from the late endosome to the golgi complex.
22637480 These data show that RUTBC2 can act as a Rab36 GAP in cells and suggest that RUTBC2 links Rab9A function to Rab36 function in the endosomal system.
22452336 Rab9A and Rab23 GTPases play crucial roles in autophagy of Group A Streptococcus.
22404213 Knockdown of RAB9A, member RAS oncogene family (RAB9A) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
21808068 RUTBC1 is a Tre2/Bub2/Cdc16 domain-containing protein that binds to Rab9A-GTP both in vitro and in cultured cells, but is not a GTPase-activating protein for Rab9A.
21563830 HIV-1 Gag co-localizes with Rab9 and TGN38 in endosomes and trans-Golgi compartments
21563830 HIV-1 Gag co-localizes with Rab9 and TGN38 in endosomes and trans-Golgi compartments
20459747 HIV-1 Gag co-localizes with Rab9 and TGN38 in endosomes and trans-Golgi compartments
More...

AA Sequence

MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR      1 - 70
SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQA     71 - 140
WCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC             141 - 201
//

Text Mined References (49)

PMID Year Title
26527546 2016 Rab9A is required for delivery of cargo from recycling endosomes to melanosomes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24480419 2013 TIP47 is associated with the hepatitis C virus and its interaction with Rab9 is required for release of viral particles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23386062 2013 Rac and Rab GTPases dual effector Nischarin regulates vesicle maturation to facilitate survival of intracellular bacteria.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23345514 2013 Identification of a role for the trans-Golgi network in human papillomavirus 16 pseudovirus infection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22637480 2012 RUTBC2 protein, a Rab9A effector and GTPase-activating protein for Rab36.
More...