Property Summary

NCBI Gene PubMed Count 113
Grant Count 106
R01 Count 62
Funding $8,073,725.13
PubMed Score 403.71
PubTator Score 52.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 0.000
astrocytoma 1.100 0.003
breast carcinoma 1.200 0.029
intraductal papillary-mucinous neoplasm ... 1.400 0.011
pediatric high grade glioma 1.300 0.002
pilocytic astrocytoma 1.200 0.003
ovarian cancer 2.700 0.000

Synonym

Accession P51149 A8K3V6 Q9NWJ0 Q9UPB0
Symbols RAB7
PRO2706

Gene

PDB

1T91   1YHN   3LAW  

Gene RIF (69)

PMID Text
26541268 show that the maturation of Mtb-containing autophagosomes into autolysosomes required recruitment of the late endosome marker RAB7, forming the intermediate compartment amphisomes
26348397 Data indicate that the secretion of microRNA miR-143, depends on rab GTP-binding proteins Rab7a and Rab27b.
26038114 We validated ANKRD13A as a novel constituent of BCR signalosome and showed that BCR-induced phosphorylation of RAB7A at S72 regulates its association with its effector proteins and with endo-lysosomal compartments.
25770103 Hepatitis B virus can regulate its own secretion through an activation of the endo-lysosomal and autophagic pathway mediated by Rab7 activation.
25566515 Bacteria controled the localization or function of host Rab5 and Rab7, and therefore modify the maturation from early to late phagosomes.[review]
25565581 regulates hepatocyte lipid droplet catabolism
25496667 Genome-wide shRNA screening identifies RAB7, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25367362 provides molecular insights into the essential role of Vps26 and Vps35 in Rab7-mediated recruitment of the core retromer complex
25180605 LKB1 promotes RAB7-mediated neuropilin-1 degradation to inhibit angiogenesis
25080504 Regulation of Rab7 activity by mutant LRRK2 in Parkinson's disease impairs membrane trafficking at very late stages of the endocytic pathway.
More...

AA Sequence

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF      1 - 70
QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ     71 - 140
AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC       141 - 207
//

Text Mined References (122)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26911690 2016 Parkin Modulates Endosomal Organization and Function of the Endo-Lysosomal Pathway.
26541268 2015 Mycobacterium tuberculosis Inhibits RAB7 Recruitment to Selectively Modulate Autophagy Flux in Macrophages.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26348397 2015 Rab7a and Rab27b control secretion of endothelial microRNA through extracellular vesicles.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25770103 2015 HBV secretion is regulated through the activation of endocytic and autophagic compartments mediated by Rab7 stimulation.
25566515 2014 The complexity of Rab5 to Rab7 transition guarantees specificity of pathogen subversion mechanisms.
25565581 2015 The small GTPase Rab7 as a central regulator of hepatocellular lipophagy.
More...