Property Summary

NCBI Gene PubMed Count 122
PubMed Score 435.43
PubTator Score 52.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 3.7e-02
astrocytoma 1.100 2.8e-03
Astrocytoma, Pilocytic 1.200 3.0e-03
breast carcinoma 1.200 2.9e-02
glioblastoma 1.100 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
ovarian cancer -1.500 3.6e-06

Gene RIF (76)

AA Sequence

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF      1 - 70
QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ     71 - 140
AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC       141 - 207
//

Text Mined References (131)

PMID Year Title