Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.92
PubTator Score 13.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.1e-05
glioblastoma 5792 1.4e-02
Disease Target Count Z-score Confidence
Argentine hemorrhagic fever 10 4.792 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma 1.300 1.4e-02
psoriasis -2.500 2.1e-05

Protein-protein Interaction (5)

Gene RIF (6)

AA Sequence

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV      1 - 70
KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS     71 - 140
KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR    141 - 210
SQCCSN                                                                    211 - 216
//

Text Mined References (32)

PMID Year Title