Property Summary

NCBI Gene PubMed Count 25
PubMed Score 401.14
PubTator Score 180.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
pancreatic cancer 2398 9.7e-03
pancreatic carcinoma 562 9.7e-03
gastric cancer 459 2.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
gastric cancer -1.200 2.8e-02
pancreatic cancer -1.700 9.7e-03
pancreatic carcinoma -1.700 9.7e-03

Gene RIF (18)

AA Sequence

MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQ      1 - 70
RMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVA     71 - 140
AGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGP    141 - 210
LVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA                           211 - 257
//

Text Mined References (26)

PMID Year Title