Property Summary

NCBI Gene PubMed Count 23
PubMed Score 380.79
PubTator Score 180.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pancreatic cancer 2300 0.00974505141834855
pancreatic carcinoma 567 0.00974505141834855
gastric cancer 436 0.0284996278361711

Expression

  Differential Expression (3)

Disease log2 FC p
gastric cancer -1.200 0.028
pancreatic cancer -1.700 0.010
pancreatic carcinoma -1.700 0.010

Synonym

Accession P51124
Symbols MET1
LMET1

Gene

PDB

1LZP   2ZGC   2ZGH   2ZGJ   2ZKS  

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG

Gene RIF (16)

PMID Text
24316590 Granzym M may be important in regulating HCMV latency and reactivation in SCT patients.
23099853 GrM is expressed in HCMV-specific CD8thorn T cells and cleaves host cell protein hnRNP K in the presence of RNA.
21979465 FADD cleavage by NK cell granzyme M enhances its self-association to facilitate procaspase-8 recruitment for auto-processing leading to caspase cascade.
21909423 GrM also exists extracellularly in plasma where it could play a physiological role in controlling blood coagulation by determining plasma FVIII levels via proteolytic processing of its carrier VWF.
21857942 Results indicate that cellular overexpression of SERPINB4 inhibits recombinant GrM-induced as well as NK cell-mediated cell death.
21059895 Noncytotoxic inhibition of cytomegalovirus replication through NK cell protease granzyme M-mediated cleavage of viral phosphoprotein 71.
20406824 survivin cleavage by Granzyme M triggers degradation of the survivin-X-linked inhibitor of apoptosis protein (XIAP) complex to free caspase activity leading to cytolysis of target tumor cells
20107908 Results describe the structural characterization of granzyme M by molecular modeling as well as by detailed comparison with other granzymes.
19896187 These findings support not only a role for GrM in the innate but also in the adaptive immune response.
19542453 Structure-based mutagenesis reveals that the amino-terminus and catalytic triad of GzmM are most essential for proteolytic function.
More...

AA Sequence

MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQ      1 - 70
RMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVA     71 - 140
AGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGP    141 - 210
LVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA                           211 - 257
//

Text Mined References (24)

PMID Year Title
24316590 2014 Elevated granzyme M-expressing lymphocytes during cytomegalovirus latency and reactivation after allogeneic stem cell transplantation.
23099853 2013 Granzyme M targets host cell hnRNP K that is essential for human cytomegalovirus replication.
21979465 2012 FADD cleavage by NK cell granzyme M enhances its self-association to facilitate procaspase-8 recruitment for auto-processing leading to caspase cascade.
21909423 2011 Cleavage of von Willebrand factor by granzyme M destroys its factor VIII binding capacity.
21857942 2011 Intracellular serine protease inhibitor SERPINB4 inhibits granzyme M-induced cell death.
21059895 2010 Noncytotoxic inhibition of cytomegalovirus replication through NK cell protease granzyme M-mediated cleavage of viral phosphoprotein 71.
20406824 2010 Cleavage of survivin by Granzyme M triggers degradation of the survivin-X-linked inhibitor of apoptosis protein (XIAP) complex to free caspase activity leading to cytolysis of target tumor cells.
20107908 2011 Granzyme M: characterization with sites of post-translational modification and specific sites of interaction with substrates and inhibitors.
19946888 2010 Defining the membrane proteome of NK cells.
19896187 2010 The cytotoxic protease granzyme M is expressed by lymphocytes of both the innate and adaptive immune system.
More...