Property Summary

NCBI Gene PubMed Count 23
Grant Count 35
R01 Count 23
Funding $3,237,780.65
PubMed Score 380.79
PubTator Score 180.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
gastric cancer -1.200 0.028
pancreatic cancer -1.700 0.010
pancreatic carcinoma -1.700 0.010

Gene RIF (16)

PMID Text
24316590 Granzym M may be important in regulating HCMV latency and reactivation in SCT patients.
23099853 GrM is expressed in HCMV-specific CD8thorn T cells and cleaves host cell protein hnRNP K in the presence of RNA.
21979465 FADD cleavage by NK cell granzyme M enhances its self-association to facilitate procaspase-8 recruitment for auto-processing leading to caspase cascade.
21909423 GrM also exists extracellularly in plasma where it could play a physiological role in controlling blood coagulation by determining plasma FVIII levels via proteolytic processing of its carrier VWF.
21857942 Results indicate that cellular overexpression of SERPINB4 inhibits recombinant GrM-induced as well as NK cell-mediated cell death.
21059895 Noncytotoxic inhibition of cytomegalovirus replication through NK cell protease granzyme M-mediated cleavage of viral phosphoprotein 71.
20406824 survivin cleavage by Granzyme M triggers degradation of the survivin-X-linked inhibitor of apoptosis protein (XIAP) complex to free caspase activity leading to cytolysis of target tumor cells
20107908 Results describe the structural characterization of granzyme M by molecular modeling as well as by detailed comparison with other granzymes.
19896187 These findings support not only a role for GrM in the innate but also in the adaptive immune response.
19542453 Structure-based mutagenesis reveals that the amino-terminus and catalytic triad of GzmM are most essential for proteolytic function.
More...

AA Sequence

MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQ      1 - 70
RMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVA     71 - 140
AGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGP    141 - 210
LVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA                           211 - 257
//

Text Mined References (24)

PMID Year Title
24316590 2014 Elevated granzyme M-expressing lymphocytes during cytomegalovirus latency and reactivation after allogeneic stem cell transplantation.
23099853 2013 Granzyme M targets host cell hnRNP K that is essential for human cytomegalovirus replication.
21979465 2012 FADD cleavage by NK cell granzyme M enhances its self-association to facilitate procaspase-8 recruitment for auto-processing leading to caspase cascade.
21909423 2011 Cleavage of von Willebrand factor by granzyme M destroys its factor VIII binding capacity.
21857942 2011 Intracellular serine protease inhibitor SERPINB4 inhibits granzyme M-induced cell death.
21059895 2010 Noncytotoxic inhibition of cytomegalovirus replication through NK cell protease granzyme M-mediated cleavage of viral phosphoprotein 71.
20406824 2010 Cleavage of survivin by Granzyme M triggers degradation of the survivin-X-linked inhibitor of apoptosis protein (XIAP) complex to free caspase activity leading to cytolysis of target tumor cells.
20107908 2011 Granzyme M: characterization with sites of post-translational modification and specific sites of interaction with substrates and inhibitors.
19946888 2010 Defining the membrane proteome of NK cells.
19896187 2010 The cytotoxic protease granzyme M is expressed by lymphocytes of both the innate and adaptive immune system.
More...