Property Summary

NCBI Gene PubMed Count 59
PubMed Score 50.89
PubTator Score 36.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.500 2.5e-04
atypical teratoid / rhabdoid tumor 1.100 3.2e-04
Breast cancer 2.300 2.8e-02
ependymoma -1.200 1.7e-08
Gaucher disease type 1 -1.600 1.2e-02
glioblastoma -1.100 7.3e-07
intraductal papillary-mucinous neoplasm ... -1.300 3.9e-03
lung adenocarcinoma 1.190 2.7e-04
lung cancer 1.200 5.5e-04
medulloblastoma, large-cell 1.100 1.4e-04
Multiple myeloma 2.053 2.4e-04
nasopharyngeal carcinoma 1.100 9.0e-04
non primary Sjogren syndrome sicca -1.100 2.6e-02
non-small cell lung cancer 1.058 1.2e-10
osteosarcoma 2.341 2.1e-06
ovarian cancer -1.600 7.4e-05
pituitary cancer 1.500 7.4e-05
primary pancreatic ductal adenocarcinoma -1.054 9.5e-03
tuberculosis -1.200 1.5e-04
Waldenstrons macroglobulinemia 1.823 1.3e-03

Gene RIF (24)

AA Sequence

MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSR      1 - 70
ANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA     71 - 140
CANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE    141 - 210
CTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLE    211 - 280
FVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL    281 - 350
LEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS    351 - 420
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTAD    421 - 490
TDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADYISRAESQSRQRNLPRETLAK    491 - 560
NKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGEEKINTLKEENTQEAAVLNGVS             561 - 621
//

Text Mined References (74)

PMID Year Title