Property Summary

NCBI Gene PubMed Count 23
Grant Count 96
R01 Count 30
Funding $32,693,789.64
PubMed Score 5.75
PubTator Score 38.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession P51003 Q86SX4 Q86TV0 Q8IYF5 Q9BVU2 PAP-alpha
Symbols PAP

Gene

Gene RIF (5)

PMID Text
26496945 Lack of CstF-64 binding excludes PAPalpha from Star-PAP target pre-mRNA UTRs.CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding poly A polymerase.
25896913 The ability of PABPN1 to promote splicing requires its RNA binding and, to a lesser extent, poly(A)polymerase (PAP) - stimulatory functions.
20174964 Observations imply that translational regulation is among the conserved mechanisms regulating PAPOLA expression.
11878934 HIV-1 Vpr dephosphorylates poly(A) polymerase (PAP), presumably through inhibition of the p34cdc2/cyclin B kinase complex, leading to enhanced PAP activity
8491200 HIV-1 Vpr dephosphorylates poly(A) polymerase (PAP), presumably through inhibition of the p34cdc2/cyclin B kinase complex, leading to enhanced PAP activity

AA Sequence

MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILGKLNN      1 - 70
LVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQ     71 - 140
EEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEI    141 - 210
LHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWE    211 - 280
WPNPVLLKQPEECNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDE    281 - 350
ILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQS    351 - 420
FPAPKENPDKEEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKR    421 - 490
KQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTSATKTSPLNSSGSSQGRNSPA    491 - 560
PAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTATQPAISPPPKPTVSRVVSSTRLVNPPPRSSG    561 - 630
NAATSGNAATKIPTPIVGVKRTSSPHKEESPKKTKTEEDETSEDANCLALSGHDKTEAKEQLDTETSTTQ    631 - 700
SETIQTAASLLASQKTSSTDLSDIPALPANPIPVIKNSIKLRLNR                             701 - 745
//

Publication (30)

PMID Year Title
26496945 2016 CstF-64 and 3'-UTR cis-element determine Star-PAP specificity for target mRNA selection by excluding PAP?.
25896913 2015 Poly(A) Polymerase and the Nuclear Poly(A) Binding Protein, PABPN1, Coordinate the Splicing and Degradation of a Subset of Human Pre-mRNAs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20174964 2010 The structure of the 5'-untranslated region of mammalian poly(A) polymerase-alpha mRNA suggests a mechanism of translational regulation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19224921 2009 Inositol 1,4,5-triphosphate receptor-binding protein released with inositol 1,4,5-triphosphate (IRBIT) associates with components of the mRNA 3' processing machinery in a phosphorylation-dependent manner and inhibits polyadenylation.
More...