Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.75
PubTator Score 38.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.125 1.5e-04
aldosterone-producing adenoma -1.688 2.2e-02
atypical teratoid/rhabdoid tumor 1.200 4.4e-04
Breast cancer -1.500 7.8e-13
chronic rhinosinusitis -1.078 1.2e-02
cystic fibrosis and chronic rhinosinusit... -1.169 1.8e-02
dermatomyositis 1.400 2.0e-04
ependymoma 1.400 1.4e-07
Gaucher disease type 1 -1.200 1.5e-02
glioblastoma 1.400 1.9e-03
group 3 medulloblastoma 1.400 1.2e-04
juvenile dermatomyositis 1.073 1.1e-09
lung adenocarcinoma 1.234 1.7e-04
lung cancer 1.100 1.4e-03
malignant mesothelioma 1.100 1.8e-05
medulloblastoma, large-cell 1.700 2.9e-06
Multiple myeloma 1.103 1.4e-02
non-small cell lung cancer -1.066 1.2e-13
osteosarcoma 1.529 7.2e-03
ovarian cancer -1.400 6.6e-09
pediatric high grade glioma -1.100 1.7e-02
primary Sjogren syndrome 1.100 8.0e-04
primitive neuroectodermal tumor 1.100 7.7e-04
psoriasis 1.200 2.2e-04
spina bifida -1.204 3.9e-02
Waldenstrons macroglobulinemia 1.449 1.5e-02

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILGKLNN      1 - 70
LVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQ     71 - 140
EEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEI    141 - 210
LHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWE    211 - 280
WPNPVLLKQPEECNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDE    281 - 350
ILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQS    351 - 420
FPAPKENPDKEEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKR    421 - 490
KQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTSATKTSPLNSSGSSQGRNSPA    491 - 560
PAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTATQPAISPPPKPTVSRVVSSTRLVNPPPRSSG    561 - 630
NAATSGNAATKIPTPIVGVKRTSSPHKEESPKKTKTEEDETSEDANCLALSGHDKTEAKEQLDTETSTTQ    631 - 700
SETIQTAASLLASQKTSSTDLSDIPALPANPIPVIKNSIKLRLNR                             701 - 745
//

Text Mined References (31)

PMID Year Title