Property Summary

NCBI Gene PubMed Count 47
PubMed Score 49.72
PubTator Score 45.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P50995 B4DVE7
Symbols ANX11
CAP50

Gene

Gene RIF (22)

PMID Text
25540196 findings suggest that AnxA11 maintains architectural and functional features of the ERES by coordinating with ALG-2 to stabilize Sec31A at the ERES.
25056970 These findings point to a role for the polymorphisms of ANXA11 in sarcoidosis in a Chinese Han population, and may be informative for future genetic studies on sarcoidosis.
24508622 the associations of Anxa11 with Ca(2+)-regulated exocytosis, cytokinesis, sex differentiation, autoimmune diseases, thrombolysis and cancers are summarized--{REVIEW}
24032725 Annexin A11 rs1049550*T allele exerts a significant protective effect on sarcoidosis susceptibility.
23579219 LIFR rs3729740 and possibly ANXA11 rs1049550 may be useful as biomarkers for predicting whether metastatic colorectal cancer patients are sensitive to relevant target regimens, although further validation in large cohorts is needed.
23151485 ANXA11 SNPs are associated with sarcoidosis in African Americans.
21562576 ANXA11 rs1049550 single nucleotide polymorphism is the susceptibility marker in sarcoidosis, at least in Caucasians.
20805159 Data confirm the strong association between variations in ANXA11 and sarcoidosis and support the hypothesis that ANXA11 represents a strong genetic risk factor for sarcoidosis.
20805159 Observational study of gene-disease association. (HuGE Navigator)
20093729 A7 and A11 have sequence repeats that form novel structures, called YP pro-beta helices, that are characterized by an ability to interact with one another
More...

AA Sequence

MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM      1 - 70
PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP     71 - 140
PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR    141 - 210
KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE    211 - 280
IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST    281 - 350
NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE    351 - 420
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS    421 - 490
GDYRKILLKICGGND                                                           491 - 505
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25724726 2015 Prostate cancer-associated autoantibodies in serum against tumor-associated antigens as potential new biomarkers.
25540196 2015 A new role for annexin A11 in the early secretory pathway via stabilizing Sec31A protein at the endoplasmic reticulum exit sites (ERES).
25056970 2014 Annexin A11 (ANXA11) gene polymorphisms are associated with sarcoidosis in a Han Chinese population: a case-control study.
24508622 2014 Annexin A11 in disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24032725 2013 Annexin A11 gene polymorphism (R230C variant) and sarcoidosis in a Portuguese population.
23579219 2013 Feasibility of proposed single-nucleotide polymorphisms as predictive markers for targeted regimens in metastatic colorectal cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...