Property Summary

NCBI Gene PubMed Count 51
PubMed Score 54.03
PubTator Score 45.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.023 1.1e-04
astrocytic glioma -1.200 2.6e-02
Chronic Lymphocytic Leukemia 1.338 2.8e-03
group 3 medulloblastoma -1.100 2.1e-02
intraductal papillary-mucinous adenoma (... 1.100 2.3e-03
intraductal papillary-mucinous carcinoma... 1.200 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 3.5e-03
invasive ductal carcinoma -1.200 1.7e-04
lung cancer -1.300 1.7e-02
malignant mesothelioma -1.100 3.2e-05
medulloblastoma, large-cell -2.300 1.7e-04
nasopharyngeal carcinoma -1.300 2.4e-08
non-small cell lung cancer -1.266 3.9e-20
oligodendroglioma -1.200 1.5e-14
osteosarcoma -1.331 9.2e-03
ovarian cancer 1.900 1.0e-04
pancreatic ductal adenocarcinoma liver m... 1.685 1.2e-02
Pick disease 1.100 8.4e-05
primitive neuroectodermal tumor -1.500 1.2e-03
psoriasis -1.500 2.4e-04
spina bifida -1.080 3.6e-02

Gene RIF (25)

AA Sequence

MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM      1 - 70
PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP     71 - 140
PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR    141 - 210
KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE    211 - 280
IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST    281 - 350
NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE    351 - 420
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS    421 - 490
GDYRKILLKICGGND                                                           491 - 505
//

Text Mined References (56)

PMID Year Title