Property Summary

Ligand Count 3
NCBI Gene PubMed Count 117
PubMed Score 136.22
PubTator Score 141.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Familial hemiplegic migraine 5 0.0 5.0
Disease Target Count Z-score Confidence
Migraine 83 7.012 3.5

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.400 1.3e-03
Atopic dermatitis -1.500 1.6e-03
atypical teratoid / rhabdoid tumor -3.200 3.7e-05
Breast cancer -1.200 7.5e-04
breast carcinoma -1.200 4.6e-12
chronic rhinosinusitis -2.002 3.9e-02
colon cancer -2.000 1.4e-02
Duchenne muscular dystrophy -1.262 4.7e-06
ductal carcinoma in situ -1.300 7.4e-04
glioblastoma -2.000 5.6e-04
group 3 medulloblastoma -3.600 1.2e-07
head and neck cancer -1.900 2.6e-02
invasive ductal carcinoma -1.200 2.5e-02
lung adenocarcinoma -2.500 1.6e-12
lung cancer -1.500 3.1e-03
medulloblastoma, large-cell -4.200 1.6e-06
nephrosclerosis 1.078 9.8e-04
non-small cell lung cancer -1.195 1.8e-11
ovarian cancer -1.300 1.9e-02
Pick disease 1.300 9.4e-04
primitive neuroectodermal tumor -1.900 5.9e-03
psoriasis -1.600 2.8e-08
subependymal giant cell astrocytoma -3.173 4.7e-02

Gene RIF (88)

AA Sequence

MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL      1 - 70
ARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGVVLAAVVIV     71 - 140
TGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCK    141 - 210
VDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRT    211 - 280
PIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMA    281 - 350
RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS    351 - 420
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSI    421 - 490
HEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSG    491 - 560
KFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGI    561 - 630
ISEGNETVEDIAARLNIPMSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVE    631 - 700
GCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLK    701 - 770
KSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK    771 - 840
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYGQEWTYEQRKV    841 - 910
VEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPL    911 - 980
KVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY                                  981 - 1020
//

Text Mined References (121)

PMID Year Title