Property Summary

NCBI Gene PubMed Count 31
PubMed Score 58.84
PubTator Score 343.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.200 6.6e-04
lung cancer 2.300 5.0e-03
Multiple myeloma 1.711 7.8e-04
ovarian cancer -1.500 4.6e-05
psoriasis 1.100 2.5e-04
Waldenstrons macroglobulinemia 1.247 7.5e-03

Gene RIF (6)

AA Sequence

MPENVAPRSGATAGAAGGRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTI      1 - 70
TNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKA     71 - 140
LEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKI    141 - 210
VKKLGGTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREER    211 - 280
AYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQ    281 - 350
FTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRA    351 - 420
LIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKT    421 - 490
AGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR                         491 - 539
//

Text Mined References (39)

PMID Year Title