Property Summary

NCBI Gene PubMed Count 30
PubMed Score 29.37
PubTator Score 19.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.663 0.002
Multiple myeloma 1.804 0.001
lung cancer 1.700 0.000
ovarian cancer 1.700 0.002
dermatomyositis 1.400 0.001

Synonym

Accession P50990 A6NN54 B4DEM7 B4DQH4 Q4VBP8 TCP-1-theta
Symbols Cctq
PRED71
D21S246
C21orf112

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
26304164 showed that high CCT8 protein expression might be related to poor outcome of glioma
25631074 Cellular biotinylated CCT8 chaperonin containing TCP1, subunit 8 (theta) protein is incorporated into HIV-1 Gag virus-like particles

AA Sequence

MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAA      1 - 70
TILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAH     71 - 140
EILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGS    141 - 210
GISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQV    211 - 280
KAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSV    281 - 350
YLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA    351 - 420
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVK    421 - 490
DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQND                491 - 548
//

Text Mined References (41)

PMID Year Title
26304164 2015 Overexpression of CCT8 and its significance for tumor cell proliferation, migration and invasion in glioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...