Property Summary

NCBI Gene PubMed Count 31
PubMed Score 31.82
PubTator Score 19.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.3e-05
lung cancer 4740 2.7e-04
dermatomyositis 966 1.1e-03
Multiple myeloma 1332 1.1e-03
Waldenstrons macroglobulinemia 765 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.400 1.1e-03
lung cancer 1.700 2.7e-04
Multiple myeloma 1.804 1.1e-03
ovarian cancer -1.600 9.3e-05
Waldenstrons macroglobulinemia 1.663 1.6e-03

Gene RIF (4)

AA Sequence

MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAA      1 - 70
TILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAH     71 - 140
EILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGS    141 - 210
GISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQV    211 - 280
KAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSV    281 - 350
YLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA    351 - 420
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVK    421 - 490
DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQND                491 - 548
//

Text Mined References (43)

PMID Year Title