Property Summary

NCBI Gene PubMed Count 27
PubMed Score 43.34
PubTator Score 34.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23166591 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L14 (RPL14), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L14 (RPL14), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQ      1 - 70
KYVRQAWQKADINTKWAATRWAKKIEARERKAKMTDFDRFKVMKAKKMRNRIIKNEVKKLQKAALLKASP     71 - 140
KKAPGTKGTAAAAAAAAAAKVPAKKITAASKKAPAQKVPAQKATGQKAAPAPKAQKGQKAPAQKAPAPKA    141 - 210
SGKKA                                                                     211 - 215
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18697920 2008 The role of human ribosomal proteins in the maturation of rRNA and ribosome production.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14567916 2003 Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.
12962325 2003 Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875025 2002 The human ribosomal protein genes: sequencing and comparative analysis of 73 genes.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11401437 2001 A complete map of the human ribosomal protein genes: assignment of 80 genes to the cytogenetic map and implications for human disorders.
11369516 2001 Inhibition of protein synthesis by the T cell receptor-inducible human TDAG51 gene product.
9480843 1998 Triplet repeat-containing ribosomal protein L14 gene in immortalized human endothelial cell line (t-HUE4).
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8722009 Structure and evolution of mammalian ribosomal proteins.
8549859 1996 Identification of trinucleotide repeat-containing genes in human pancreatic islets.
8325628 1993 Novel triplet repeat containing genes in human brain: cloning, expression, and length polymorphisms.
8244780 1993 Restricted usage of T-cell receptor V alpha sequence and variable-joining pairs after normal T-cell development and bone marrow transplantation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.