Property Summary

NCBI Gene PubMed Count 56
PubMed Score 433.82
PubTator Score 351.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Blindness 88 3.263 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 7.2e-03
Breast cancer 2.100 4.8e-02
diabetes mellitus -1.500 4.5e-03
Duchenne muscular dystrophy 1.050 2.9e-08
intraductal papillary-mucinous adenoma (... -1.100 1.3e-02
invasive ductal carcinoma 1.200 1.4e-03
Multiple myeloma 2.095 1.2e-05
ovarian cancer -1.400 8.1e-06
tuberculosis 1.100 2.6e-06
ulcerative colitis 1.400 5.3e-05
Waldenstrons macroglobulinemia 1.731 1.8e-02

Gene RIF (22)

AA Sequence

MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSL      1 - 70
EIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVG     71 - 140
GQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERG    141 - 210
INESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQL    211 - 280
VFLATEGDHLQLSEEWFYAHIIPFLG                                                281 - 306
//

Text Mined References (61)

PMID Year Title