Property Summary

NCBI Gene PubMed Count 62
Grant Count 25
R01 Count 12
Funding $3,042,358.56
PubMed Score 221.51
PubTator Score 130.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -1.300 0.001
lung carcinoma 2.200 0.000

Gene RIF (30)

PMID Text
26137540 Cytometry analysis evidenced a specific expression profile on reticulocytes of SCA infants, with notably an increased expression of the adhesion molecules Lu/BCAM, ICAM-4 and LFA-3, both in percentage of positive cells and in surface density.
25809027 The variable levels of expression of mutated JAK2 and BCAM proteins determine different adhesion patterns of erythrocytes from polycythemia vera patients.
25582271 Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients.
25051049 High BCAM expression is associated with hepatocellular carcinoma.
24616094 Adhesion of sickle reticulocytes to HC-treated endothelial cells was decreased despite the HC-derived increase of Lu/BCAM expression.
24453976 These studies revealed amino acids 720 to 1014 of CNF1 as the binding site for Lu/BCAM.
24036115 tumor cell migration on LM-511 requires that Lu/B-CAM competitively modulates cell attachment through integrins.
23421542 Glu425 in the Lu glycoprotein is required for expression of Lu7, and Ala425 is associated with the LU:-7 phenotype. This completes the molecular basis associated with all antigens known to be in the Lutheran blood group system.
23168236 DARC and BCAM expression was associated with pathogenesis of thyroid carcinoma and correlated with clinical-pathological features.
22404936 Increases in adhesion frequency provide significant evidence of the role of epinephrine in BCAM/Lu-laminin and ICAM-4-alpha(v)beta(3) bonding, and suggest mechanisms of vaso-occlusion during physical exertion in sickle cell trait.
More...

AA Sequence

MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTD      1 - 70
RSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATAR     71 - 140
LNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVR    141 - 210
EASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGW    211 - 280
VREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQL    281 - 350
SKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG    351 - 420
TYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGG    421 - 490
SPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGL    491 - 560
LLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC      561 - 628
//

Text Mined References (68)

PMID Year Title
26137540 2015 Erythroid Adhesion Molecules in Sickle Cell Anaemia Infants: Insights Into Early Pathophysiology.
25809027 2015 Lu/BCAM-mediated cell adhesion as biological marker of JAK2V617F activity in erythrocytes of polycythemia vera patients.
25582271 2015 Erythrocyte genotyping for transfusion-dependent patients at the Azienda Universitaria Policlinico of Naples.
25416956 2014 A proteome-scale map of the human interactome network.
25051049 2014 Soluble Lutheran/basal cell adhesion molecule is detectable in plasma of hepatocellular carcinoma patients and modulates cellular interaction with laminin-511 in vitro.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24616094 2014 Hydroxycarbamide decreases sickle reticulocyte adhesion to resting endothelium by inhibiting endothelial lutheran/basal cell adhesion molecule (Lu/BCAM) through phosphodiesterase 4A activation.
24453976 2014 Lu/BCAM adhesion glycoprotein is a receptor for Escherichia coli Cytotoxic Necrotizing Factor 1 (CNF1).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036115 2013 The lutheran/basal cell adhesion molecule promotes tumor cell migration by modulating integrin-mediated cell attachment to laminin-511 protein.
More...