Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.76
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P50876 D6W4Y6 Q585H5
Symbols RNF144
UBCE7IP4

Gene

PANTHER Protein Class (2)

PDB

1WIM  

Gene RIF (5)

PMID Text
26216882 both proper membrane localization and self-association are important for RNF144A function.
24979766 The regulation of DNA-PKcs by RNF144A is important for proper apoptotic response during DNA damage, suggesting a tumor suppressor function for RNF144A.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20195266 Clinical trial and genome-wide association study of gene-disease association. (HuGE Navigator)
10431818 Functional analysis of the mouse counterpart.

AA Sequence

MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAAC      1 - 70
PKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRM     71 - 140
EFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAF    141 - 210
CWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKC    211 - 280
KCSKGDDDPLPT                                                              281 - 292
//

Text Mined References (12)

PMID Year Title
26216882 2015 Regulation of RNF144A E3 Ubiquitin Ligase Activity by Self-association through Its Transmembrane Domain.
24979766 2014 RNF144A, an E3 ubiquitin ligase for DNA-PKcs, promotes apoptosis during DNA damage.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
10431818 1999 A family of structurally related RING finger proteins interacts specifically with the ubiquitin-conjugating enzyme UbcM4.
More...