Property Summary

NCBI Gene PubMed Count 228
Grant Count 354
R01 Count 221
Funding $29,522,121.67
PubMed Score 712.30
PubTator Score 371.20

Knowledge Summary

Patent (62,312)

Expression

  Differential Expression (1)

Disease log2 FC p
Gaucher disease type 3 1.100 0.001

Synonym

Accession P50750 Q5JU24 Q5JU25 Q5U006 Q96TF1
Symbols TAK
C-2k
CTK1
CDC2L4
PITALRE

Gene

PDB

4IMY   4OGR   4OR5   1PF6   3BLH   3BLQ   3BLR   3LQ5   3MI9   3MIA   3MY1   3TN8   3TNH   3TNI   4BCF   4BCG   4BCH   4BCI   4BCJ   4EC8   4EC9  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (504)

PMID Text
26573875 Our findings suggest a potential role of CDK9 in the radiation response of head and neck squamous cell carcinoma cells
26555090 In vitro phosphorylation of pUL69 by CDK9 or pUL97 did not occur in a single site-specific manner, but at multiple sites.
26209609 Systematic Determination of Human CDK9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DDX5 and DDX17 RNA Helicases
26188041 PPP1R10 (PNUTS) may downregulate HIV transcription by preventing the assembly of a functional P-TEFb complex (CCNT1-CDK9) (shown to affect HIV-1 transcription)
26083714 Essential for MYC expreession increase upon CDK9 inhibition is that the bromodomain protein BRD4 captures P-TEFb from 7SK snRNP to deliver to target genes and also enhances CDK9's activity and resistance to inhibition.
25992613 miR-191 represses proliferation in primary human fibroblasts via targeting multiple proto-oncogenes, including CDK9, NOTCH2, and RPS6KA3.
25931145 Transcription is effective if RELA recruits the positive transcription elongation factor b (P-TEFb) component CDK9 to a combined RELA/STAT3 binding site -50 to -20bp upstream of the start site of the IL-12p35 promoter
25909811 the introduction of HIV-1 Tat and Mg12+ ion resulted in the active site architectural characteristics of phosphorylated CDK9/cyclin T1 complex
25909811 Binding of HIV-1 Tat to CDK9 stabilizes hydrogen bonds between ATP and residues Lys48, Asp104, and Cys106 and facilitates the salt bridge network pertaining to the phosphorylated Thr186 at the activation loop
25909811 Binding of HIV-1 Tat to CDK9 stabilizes hydrogen bonds between ATP and residues Lys48, Asp104, and Cys106 and facilitates the salt bridge network pertaining to the phosphorylated Thr186 at the activation loop
More...

AA Sequence

MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKIL      1 - 70
QLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYI     71 - 140
HRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPI    141 - 210
DLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLK    211 - 280
AYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQIT    281 - 350
QQSTNQSRNPATTNQTEFERVF                                                    351 - 372
//

Text Mined References (252)

PMID Year Title
26573875 2016 The impact of CDK9 on radiosensitivity, DNA damage repair and cell cycling of HNSCC cancer cells.
26555090 2016 New insight into the phosphorylation-regulated intranuclear localization of human cytomegalovirus pUL69 mediated by cyclin-dependent kinases (CDKs) and viral CDK orthologue pUL97.
26209609 2015 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box (DDX)-5/17 RNA Helicases.
26083714 2015 Compensatory induction of MYC expression by sustained CDK9 inhibition via a BRD4-dependent mechanism.
25992613 2015 MiR-191 Regulates Primary Human Fibroblast Proliferation and Directly Targets Multiple Oncogenes.
25931145 2015 JAK1/STAT3 activation directly inhibits IL-12 production in dendritic cells by preventing CDK9/P-TEFb recruitment to the p35 promoter.
25909811 2015 Determining the Functions of HIV-1 Tat and a Second Magnesium Ion in the CDK9/Cyclin T1 Complex: A Molecular Dynamics Simulation Study.
25596730 2015 Up-regulation of CDK9 kinase activity and Mcl-1 stability contributes to the acquired resistance to cyclin-dependent kinase inhibitors in leukemia.
25281924 2014 MicroRNA-874 inhibits cell proliferation and induces apoptosis in human breast cancer by targeting CDK9.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
More...