Property Summary

Ligand Count 3
NCBI Gene PubMed Count 45
PubMed Score 223.30
PubTator Score 312.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 3.1e-03
osteosarcoma 1.012 4.3e-03

Protein-protein Interaction (1)

Gene RIF (25)

AA Sequence

MEDRLHMDNGLVPQKIVSVHLQDSTLKEVKDQVSNKQAQILEPKPEPSLEIKPEQDGMEHVGRDDPKALG      1 - 70
EEPKQRRGSASGSEPAGDSDRGGGPVEHYHLHLSSCHECLELENSTIESVKFASAENIPDLPYDYSSSLE     71 - 140
SVADETSPEREGRRVNLTGKAPNILLYVGSDSQEALGRFHEVRSVLADCVDIDSYILYHLLEDSALRDPW    141 - 210
TDNCLLLVIATRESIPEDLYQKFMAYLSQGGKVLGLSSSFTFGGFQVTSKGALHKTVQNLVFSKADQSEV    211 - 280
KLSVLSSGCRYQEGPVRLSPGRLQGHLENEDKDRMIVHVPFGTRGGEAVLCQVHLELPPSSNIVQTPEDF    281 - 350
NLLKSSNFRRYEVLREILTTLGLSCDMKQVPALTPLYLLSAAEEIRDPLMQWLGKHVDSEGEIKSGQLSL    351 - 420
RFVSSYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNLQTKQLGKVILFAEVTPTTMRLLDGLMFQTP    421 - 490
QEMGLIVIAARQTEGKGRGGNVWLSPVGCALSTLLISIPLRSQLGQRIPFVQHLMSVAVVEAVRSIPEYQ    491 - 560
DINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLITEYNKQHKAELKP    561 - 630
LRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQE    631 - 700
GGEVVTVHPDGNSFDMLRNLILPKRR                                                701 - 726
//

Text Mined References (55)

PMID Year Title