Property Summary

NCBI Gene PubMed Count 44
Grant Count 22
R01 Count 15
Funding $6,036,470.88
PubMed Score 192.76
PubTator Score 312.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.012 0.004
breast carcinoma 1.100 0.003

Gene RIF (24)

PMID Text
24840043 Data suggest that direct interactions of HLCS (holocarboxylase synthetase) with NCOR1 (nuclear receptor corepressor 1) and HDAC1 (histone deacetylase 1) contribute toward transcriptional repression of repeats, presumably increasing genome stability.
24239178 The transcriptional function of HCS was shown by in vitro pull down and in vivo co-immunoprecipitation assays to depend on its interaction with the histone deacetylases HDAC1, HDAC2 and HDAC7
24133061 This study showed that modification of HSP72 and demonstrated that binding of biotin to extracellular HSP72 prepares cells for a strong immune response.
24075901 study characterizes three functional promoters in the human HLCS gene
23624957 HLCS interacts physically with the DNA methyltransferase DNMT1 and the methyl CpG binding protein MeCP2 to facilitate the binding of HLCS to chromatin.
22027809 individuals with HLCS SNPs may benefit from supplemental biotin, yet to different extents depending on the genotype
21802411 HLCS methionine-58 is a functional translation start site in human cells.
20688500 Holocarboxylase synthetase interacts directly with histone H3, causing biotinylation of lysine K9 and K18.
20592104 The results of this study suggest that miR-539 is among the factors sensing biotin and regulating holocarboxylase synthetase expression.
20153287 the localisation of HCS and its isoforms
More...

AA Sequence

MEDRLHMDNGLVPQKIVSVHLQDSTLKEVKDQVSNKQAQILEPKPEPSLEIKPEQDGMEHVGRDDPKALG      1 - 70
EEPKQRRGSASGSEPAGDSDRGGGPVEHYHLHLSSCHECLELENSTIESVKFASAENIPDLPYDYSSSLE     71 - 140
SVADETSPEREGRRVNLTGKAPNILLYVGSDSQEALGRFHEVRSVLADCVDIDSYILYHLLEDSALRDPW    141 - 210
TDNCLLLVIATRESIPEDLYQKFMAYLSQGGKVLGLSSSFTFGGFQVTSKGALHKTVQNLVFSKADQSEV    211 - 280
KLSVLSSGCRYQEGPVRLSPGRLQGHLENEDKDRMIVHVPFGTRGGEAVLCQVHLELPPSSNIVQTPEDF    281 - 350
NLLKSSNFRRYEVLREILTTLGLSCDMKQVPALTPLYLLSAAEEIRDPLMQWLGKHVDSEGEIKSGQLSL    351 - 420
RFVSSYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNLQTKQLGKVILFAEVTPTTMRLLDGLMFQTP    421 - 490
QEMGLIVIAARQTEGKGRGGNVWLSPVGCALSTLLISIPLRSQLGQRIPFVQHLMSVAVVEAVRSIPEYQ    491 - 560
DINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLITEYNKQHKAELKP    561 - 630
LRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQE    631 - 700
GGEVVTVHPDGNSFDMLRNLILPKRR                                                701 - 726
//

Text Mined References (54)

PMID Year Title
25690727 2015 Severe neonatal holocarboxylase synthetase deficiency in west african siblings.
24840043 2014 Holocarboxylase synthetase interacts physically with nuclear receptor co-repressor, histone deacetylase 1 and a novel splicing variant of histone deacetylase 1 to repress repeats.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239178 2014 Holocarboxylase synthetase acts as a biotin-independent transcriptional repressor interacting with HDAC1, HDAC2 and HDAC7.
24133061 2013 Holocarboxylase synthetase catalyzes biotinylation of heat shock protein 72, thereby inducing RANTES expression in HEK-293 cells.
24075901 2013 Three promoters regulate the transcriptional activity of the human holocarboxylase synthetase gene.
23624957 2013 Holocarboxylase synthetase synergizes with methyl CpG binding protein 2 and DNA methyltransferase 1 in the transcriptional repression of long-terminal repeats.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22027809 2012 Effects of single-nucleotide polymorphisms in the human holocarboxylase synthetase gene on enzyme catalysis.
21802411 2011 Human holocarboxylase synthetase with a start site at methionine-58 is the predominant nuclear variant of this protein and has catalytic activity.
More...