Property Summary

NCBI Gene PubMed Count 47
Grant Count 1
Funding $78,577.29
PubMed Score 42.55
PubTator Score 112.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Endometriosis -1.189 0.045
Rheumatoid Arthritis 1.400 0.022
pancreatic cancer -1.100 0.000
adrenocortical carcinoma -1.423 0.000
lung cancer -1.700 0.007
interstitial cystitis -1.300 0.000
posterior fossa group B ependymoma 1.400 0.000
pancreatic carcinoma -1.100 0.000
spina bifida -1.496 0.037
Pick disease 1.200 0.000
ductal carcinoma in situ 1.200 0.002
invasive ductal carcinoma 1.500 0.005
acute myeloid leukemia 1.300 0.003
ovarian cancer -2.200 0.000
Down syndrome 1.300 0.005
chronic rhinosinusitis -1.340 0.027

Synonym

Accession P50616 B2R9T0 D3DTY3 Q4KMQ0
Symbols TOB
TROB
APRO5
APRO6
PIG49
TROB1

Gene

 Grant Application (1)

PDB

2D5R   2Z15   5CI8   5CI9  

Gene RIF (30)

PMID Text
26165839 A novel role for TOB1 in mediating survival of estrogen-independent breast cancers.
25760308 Reduced TOB1 expression in gastric adenocarcinoma is associated with the extent of differentiation and the TNM stage of gastric cancer.
25446091 arsenite-induced oxidative stress inhibits deadenylation of mRNA primarily through downregulation of Tob and Pan3, both of which mediate the recruitment of deadenylases to mRNA
25043310 miR-25 promotes GC progression by directly downregulating TOB1 expression, and may be a noninvasive biomarker for the prognosis of GC patients.
23756562 TOB1 demonstrated a radioprotective function in the immortalized normal human bronchial epithelial cell line.
23589165 TOB1 modulates the radiosensitivity of lung cancer cells via the MAPK/ERK signaling pathway.
23178487 Tob is a key factor in the regulation of c-myc gene expression, which is essential for cell growth.
23066029 Cdc7 phosphorylates and interacts with Tob to inhibit the Cul4-DDB1(Cdt2)-dependent Tob degradation.
22710759 study demonstrates that the overexpression of Tob1 inhibits gastric cancer progression by activating Smad4- and inhibiting betacatenin-mediated signaling pathways
22252318 The antiproliferative and the mRNA deadenylation/decay-promoting effects of TOB1 and TOB2 proteins are linked.
More...

AA Sequence

MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQ      1 - 70
ASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFM     71 - 140
PISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLG    141 - 210
LNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQ    211 - 280
GQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN         281 - 345
//

Text Mined References (52)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26165839 2016 Acquisition of estrogen independence induces TOB1-related mechanisms supporting breast cancer cell proliferation.
25760308 2015 Clinicopathological significance of cytoplasmic transducer of ErbB2. 1 expression in gastric cancer.
25446091 2014 Arsenite inhibits mRNA deadenylation through proteolytic degradation of Tob and Pan3.
25043310 2015 MicroRNA-25 promotes gastric cancer migration, invasion and proliferation by directly targeting transducer of ERBB2, 1 and correlates with poor survival.
23756562 2013 Overexpression of TOB1 confers radioprotection to bronchial epithelial cells through the MAPK/ERK pathway.
23589165 2013 Enhanced radiosensitivity of NSCLC cells by transducer of erbB2.1 (TOB1) through modulation of the MAPK/ERK pathway.
23236473 2012 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178487 2014 Antiproliferative protein Tob directly regulates c-myc proto-oncogene expression through cytoplasmic polyadenylation element-binding protein CPEB.
More...