Property Summary

NCBI Gene PubMed Count 49
PubMed Score 44.05
PubTator Score 112.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Endometriosis -1.189 4.5e-02
acute myeloid leukemia 1.300 3.0e-03
adrenocortical carcinoma -1.423 1.4e-04
chronic rhinosinusitis -1.340 2.7e-02
Down syndrome 1.300 4.8e-03
ductal carcinoma in situ 1.200 1.8e-03
interstitial cystitis -1.200 1.0e-03
invasive ductal carcinoma 1.500 5.3e-03
lung cancer -1.700 7.4e-03
ovarian cancer -2.200 3.3e-07
pancreatic cancer -1.100 3.6e-04
pancreatic carcinoma -1.100 3.6e-04
Pick disease 1.200 6.7e-05
posterior fossa group A ependymoma 1.100 6.8e-04
Rheumatoid arthritis 1.400 2.2e-02
spina bifida -1.496 3.7e-02

Synonym

Accession P50616 B2R9T0 D3DTY3 Q4KMQ0
Symbols TOB
TROB
APRO5
APRO6
PIG49
TROB1

Gene

PDB

2D5R   2Z15   5CI8   5CI9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (32)

AA Sequence

MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQ      1 - 70
ASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFM     71 - 140
PISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLG    141 - 210
LNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQ    211 - 280
GQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN         281 - 345
//

Text Mined References (54)

PMID Year Title