Property Summary

NCBI Gene PubMed Count 118
Grant Count 128
R01 Count 83
Funding $15,739,819.41
PubMed Score 191.08
PubTator Score 507.36

Knowledge Summary

Patent (20,663)

Expression

Synonym

Accession P50613 Q9BS60 Q9UE19
Symbols CAK
CAK1
HCAK
MO15
STK1
CDKN7
p39MO15

Gene

PDB

1LG3   1PA8   1UA2   2HIC  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1380 confirmatory 1 / 0 / 17 CDK7 counterscreen of confirmed PKD inhibitors-57K library addition
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (77)

PMID Text
26406377 Study shows that triple-negative but not hormone receptor-positive breast cancer cells are exceptionally dependent on CDK7, a transcriptional cyclin-dependent kinase.
26257281 Cdk7 broadly influences transcription and capping.
25820824 Our results indicated that CCNH/CDK7-CtBP2 axis may augment ESCC cell migration, and targeting the interaction of both may provide a novel therapeutic target of esophageal squamous cell carcinoma .
25047832 Data suggest a quantitative contribution of CDK7 to mRNA synthesis, which is critical for cellular homeostasis.
24565118 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIH, during Tat-mediated transactivation of the HIV-1 LTR
23827503 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIH, during Tat-mediated transactivation of the HIV-1 LTR
23737759 CDK7 involved in phosphorylation/activation of CDK4 and CDK6; existence of CDK4-activating kinase(s) other than CDK7; and novel CDK7-dependent positive feedbacks mediated by p21 phosphorylation by CDK4 and CDK2 to sustain CDK4 activation.
23622515 Activating phosphorylation of Cdk7 rises concurrently with that of Cdk4 as cells exit quiescence and accelerates Cdk4 activation in vitro.
23532886 Data indicate that TG02 blocked signaling by CDKs 1, 2, 7, and 9 and ERK5, leading to potent and highly consistent antimyeloma activity.
23456497 CCNH and CDK7 may play an important role in the tumorigenesis and development of esophageal squamous cell carcinoma.
More...

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS      1 - 70
HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKP     71 - 140
NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV    141 - 210
PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP    211 - 280
CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF        281 - 346
//

Text Mined References (141)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26406377 2015 CDK7-dependent transcriptional addiction in triple-negative breast cancer.
26257281 2015 THZ1 Reveals Roles for Cdk7 in Co-transcriptional Capping and Pausing.
25820824 2015 Interaction with CCNH/CDK7 facilitates CtBP2 promoting esophageal squamous cell carcinoma (ESCC) metastasis via upregulating epithelial-mesenchymal transition (EMT) progression.
25047832 2014 Cyclin-dependent kinase 7 controls mRNA synthesis by affecting stability of preinitiation complexes, leading to altered gene expression, cell cycle progression, and survival of tumor cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23737759 2013 CDK4 T172 phosphorylation is central in a CDK7-dependent bidirectional CDK4/CDK2 interplay mediated by p21 phosphorylation at the restriction point.
23622515 2013 A Cdk7-Cdk4 T-loop phosphorylation cascade promotes G1 progression.
23532886 2013 Potent antimyeloma activity of a novel ERK5/CDK inhibitor.
23456497 2013 Low expression of cyclinH and cyclin-dependent kinase 7 can decrease the proliferation of human esophageal squamous cell carcinoma.
More...