Property Summary

NCBI Gene PubMed Count 25
Grant Count 16
R01 Count 11
Funding $1,869,363.25
PubMed Score 263.82
PubTator Score 180.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
24664737 Tubby and Tulp1 mediated phagocytosis through MerTK-dependent signaling with non-muscle myosin II redistribution leading to colocalization of phagocytosed vesicles with rearranged NMMIIA.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of tubby homolog, mouse (TUB) in U-937 macrophages
20978472 Tubby and Tulp1 are bridging molecules with their N-terminal region as MERTK-binding domain and C-terminal region as phagocytosis prey-binding domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837063 Tubby and Tulp1 function as phagocytosis sigmals (eat-me) for retinal pigment epithelium cells and other phagocytes.
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18183286 Genetic variation of the TUB gene was associated with both body composition and macronutrient intake, suggesting that TUB might influence eating behavior
More...

AA Sequence

MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQSEEQAPL      1 - 70
VESYLSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAAL     71 - 140
AEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMSFDEDEEDEEENSSSS    141 - 210
SQLNSNTRPSSATSRKSVREAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGM    211 - 280
YPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNP    281 - 350
QKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTE    351 - 420
SIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQ    421 - 490
AFAIALSSFDSKLACE                                                          491 - 506
//

Text Mined References (26)

PMID Year Title
24664737 2014 Synergistic interaction of tubby and tubby-like protein 1 (Tulp1).
24375934 2014 A homozygous mutation in the TUB gene associated with retinal dystrophy and obesity.
20978472 2010 Tubby and tubby-like protein 1 are new MerTK ligands for phagocytosis.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20889716 2010 TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837063 2010 Identification of tubby and tubby-like protein 1 as eat-me signals by phage display.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
More...