Property Summary

NCBI Gene PubMed Count 25
PubMed Score 272.58
PubTator Score 180.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Retinal Dystrophy and Obesity 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Retinitis Pigmentosa 226

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.100 4.7e-02
adrenocortical carcinoma -1.036 2.8e-02
adult high grade glioma -2.000 1.1e-06
atypical teratoid / rhabdoid tumor -1.700 3.0e-04
Breast cancer -1.300 3.2e-05
breast carcinoma -1.100 1.1e-04
chronic rhinosinusitis -1.127 6.5e-03
cystic fibrosis and chronic rhinosinusit... -1.050 1.2e-02
ependymoma -1.200 4.2e-07
glioblastoma -1.500 3.9e-05
group 3 medulloblastoma -1.100 2.0e-03
interstitial cystitis -1.300 7.6e-03
intraductal papillary-mucinous adenoma (... -1.300 1.1e-04
intraductal papillary-mucinous carcinoma... -1.400 6.7e-05
intraductal papillary-mucinous neoplasm ... -1.100 5.8e-03
invasive ductal carcinoma -1.184 2.5e-03
medulloblastoma, large-cell -1.900 1.3e-04
osteosarcoma 1.577 1.4e-05
ovarian cancer -2.100 3.3e-12
Pick disease -1.200 8.0e-04
subependymal giant cell astrocytoma -1.980 3.4e-02

Gene RIF (18)

AA Sequence

MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQSEEQAPL      1 - 70
VESYLSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAAL     71 - 140
AEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMSFDEDEEDEEENSSSS    141 - 210
SQLNSNTRPSSATSRKSVREAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGM    211 - 280
YPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNP    281 - 350
QKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTE    351 - 420
SIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQ    421 - 490
AFAIALSSFDSKLACE                                                          491 - 506
//

Text Mined References (26)

PMID Year Title