Property Summary

NCBI Gene PubMed Count 747
PubMed Score 661.87
PubTator Score 3727.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 5.522 2.8

Expression

  Differential Expression (38)

Disease log2 FC p
glioblastoma 1.400 3.5e-04
active Crohn's disease 1.525 6.8e-03
active ulcerative colitis 1.225 1.4e-02
adrenocortical carcinoma -1.135 2.6e-03
adult high grade glioma 1.900 2.1e-03
aldosterone-producing adenoma -2.028 1.1e-02
Astrocytoma, Pilocytic 1.700 3.2e-06
Atopic dermatitis 1.300 8.6e-04
atypical teratoid / rhabdoid tumor 1.100 1.8e-02
colon cancer -1.100 4.0e-02
COPD -1.500 4.3e-02
cutaneous lupus erythematosus 1.500 2.7e-03
cystic fibrosis 1.273 1.5e-05
Duchenne muscular dystrophy 1.177 1.1e-04
Endometriosis -1.258 1.2e-02
ependymoma -2.400 1.7e-02
Gaucher disease type 3 -1.500 2.4e-02
hepatocellular carcinoma 1.200 3.1e-03
intraductal papillary-mucinous adenoma (... 1.300 7.2e-03
intraductal papillary-mucinous carcinoma... 1.600 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.900 6.5e-03
juvenile dermatomyositis 3.049 1.5e-18
lung cancer -4.300 1.0e-05
lung carcinoma -2.700 9.2e-17
malignant mesothelioma -1.700 5.3e-06
medulloblastoma 1.200 1.5e-02
mucosa-associated lymphoid tissue lympho... 1.480 2.1e-02
Multiple myeloma 1.080 2.0e-02
Multiple Sclerosis 1.500 3.3e-02
oligodendroglioma -1.800 2.5e-02
ovarian cancer 1.800 3.8e-03
pancreatic cancer 1.100 2.2e-02
pituitary cancer -1.200 1.8e-03
primary pancreatic ductal adenocarcinoma 1.186 1.2e-02
primitive neuroectodermal tumor 1.600 2.5e-02
psoriasis 1.400 1.9e-06
subependymal giant cell astrocytoma 2.236 3.4e-02
tuberculosis 2.500 6.8e-05

Protein-protein Interaction (5)

Gene RIF (727)

AA Sequence

MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDE      1 - 70
ESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN     71 - 140
SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYI    141 - 210
YKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLV    211 - 280
G//

Text Mined References (749)

PMID Year Title