Property Summary

NCBI Gene PubMed Count 693
PubMed Score 627.14
PubTator Score 3727.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.52587269171022E-18
lung carcinoma 2844 9.18512794137786E-17
pilocytic astrocytoma 3086 2.63321541755888E-7
malignant mesothelioma 3163 5.321782350379E-6
lung cancer 4473 1.92474833162669E-5
pediatric high grade glioma 2712 2.5907712044339E-5
tuberculosis 1563 6.76163002642194E-5
cystic fibrosis 1670 7.52459476680099E-5
Duchenne muscular dystrophy 602 1.06263174777118E-4
psoriasis 6685 2.16289619460284E-4
hepatocellular carcinoma 550 4.95939296815528E-4
cutaneous lupus erythematosus 1056 5.83398494597415E-4
pituitary cancer 1972 7.01546574474877E-4
Atopic dermatitis 944 8.60741821455416E-4
sonic hedgehog group medulloblastoma 1482 0.00119946098364242
adrenocortical carcinoma 1427 0.00263999321581535
ovarian cancer 8492 0.00379201816558704
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00722078780752894
active Crohn's disease 918 0.00898903036188619
primary pancreatic ductal adenocarcinoma 1271 0.0120546683801618
Endometriosis 535 0.0120848772050226
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0134372105840636
aldosterone-producing adenoma 664 0.0140471259418131
active ulcerative colitis 477 0.0140672494329318
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0164786702418196
ependymoma 2514 0.0167069807639232
atypical teratoid / rhabdoid tumor 4369 0.0178133605857818
Multiple myeloma 1328 0.0204172305289783
mucosa-associated lymphoid tissue lymphoma 480 0.0210116331374468
pancreatic cancer 2300 0.0223915835396466
oligodendroglioma 2849 0.0253015492516456
primitive neuroectodermal tumor 3031 0.0253591201316734
Multiple Sclerosis 498 0.0326688143550736
subependymal giant cell astrocytoma 2287 0.0338251677266762
Gaucher disease type 3 76 0.0344187445240441
colon cancer 1475 0.040393359384652
COPD 116 0.0426298553549866
Disease Target Count Z-score Confidence
Cancer 2346 5.486 2.7

Expression

Synonym

Accession P50591 A1Y9B3
Symbols TL2
APO2L
CD253
TRAIL
Apo-2L
TNLG6A

Gene

PDB

1D0G   1D2Q   1D4V   1DG6   1DU3   4N90  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 IMPC Term (1)

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1443 screening 883 / 0 / 216304 uHTS for the identification of compounds that potentiate TRAIL-induced apoptosis of cancer cells
1624 confirmatory 3 / 0 / 0 Confirmation screening of compounds that potentiate TRAIL-induced apoptosis of cancer cells.
1640 summary 2 / 0 / 0 Summary of compounds that potentiate TRAIL-induced apoptosis of cancer cells.
1745 other 0 / 0 / 3 Confirmation screening of compounds that potentiate TRAIL-induced apoptosis in normal 184B5 cells
1746 other 3 / 0 / 0 Confirmation screening of compounds that potentiate TRAIL-induced apoptosis in primary human hepatocytes.
1747 other 3 / 0 / 0 Confirmation screening of compounds that potentiate TRAIL-induced apoptosis in TRAIL-resistant cancer cells, MDA-MB-435
1748 other 1 / 0 / 2 Confirmation screening of compounds that potentiate TRAIL-induced apoptosis in TRAIL-resistant cancer cells, MCF7
1752 confirmatory 3 / 0 / 7 SAR analysis of compounds that potentiate TRAIL-induced apoptosis in PPC-1 cells.
1755 confirmatory 3 / 0 / 7 SAR analysis of compounds that potentiate TRAIL-induced apoptosis in MDA-MB-435 cells.
1765 other 2 / 0 / 1 Mechanism of action of compounds that potentiate TRAIL-induced apoptosis in PPC-1 cells
More...

Gene RIF (674)

PMID Text
26962689 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells
26871575 HMGB1 as a trigger for IFN-alpha-mediated TRAIL expression at the surface of Plasmacytoid dendritic cells (pDCs) and Natural Killer (NK) Cells, and they suggest a novel mechanism of innate control of HIV-1 infection.
26841509 NF-kB Activation Inhibitor IV and JSH-23 reduced resistance in the acute myeloid leukemia cells in multicellular aggregates to cytotoxic action of recombinant protein izTRAIL.
26802603 Smad2 enhances TRAIL-induced apoptosis in activated hepatic stellate cells, which facilitates the resolution of hepatic fibrosis
26792723 Collectively, these studies define Sig1R as a key mediator of TRAIL induction of cancer-specific killing.
26721202 Valproic acid sensitized TRAIL-resistant papillary thyroid carcinoma cells to apoptotic cell death through involvement of Nrf2 and Bcl-xL.
26720004 Bay 61-3606 downregulates Mcl-1 expression in breast cancer cells and sensitizes cancer cells to TRAIL-mediated apoptosis.
26718429 TRAIL genetic polymorphisms do not contribute, but DR4 polymorphisms may contribute to susceptibility to head and neck cancer in Pakistani population.
26648023 Our findings suggested that GA induces apoptosis via the downregulation of cFLIPL and sensitized TRAIL-mediated apoptosis in Caki cells.
26633016 showed that the level of blood cholesterol was significantly higher in subjects in the upper quartile of serum TRAIL. In conclusion, our data demonstrate that the serum TRAIL concentration is elevated in people with hypercholesterolemia
More...

AA Sequence

MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDE      1 - 70
ESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN     71 - 140
SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYI    141 - 210
YKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLV    211 - 280
G//

Text Mined References (696)

PMID Year Title
26962689 2016 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells.
26871575 2016 HMGB1 Is Involved in IFN-? Production and TRAIL Expression by HIV-1-Exposed Plasmacytoid Dendritic Cells: Impact of the Crosstalk with NK Cells.
26841509 [Inhibition of NF-kB Activation Decreases Resistance in Acute Myeloid Leukemia Cells to TRAIL-induced Apoptosis in Multicellular Aggregates].
26802603 2016 Smad2 increases the apoptosis of activated human hepatic stellate cells induced by TRAIL.
26792723 2016 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) activates caspases in human prostate cancer cells through sigma 1 receptor.
26721202 2016 Downregulation of Nrf2 by the combination of TRAIL and Valproic acid induces apoptotic cell death of TRAIL-resistant papillary thyroid cancer cells via suppression of Bcl-xL.
26720004 2015 Bay 61-3606 Sensitizes TRAIL-Induced Apoptosis by Downregulating Mcl-1 in Breast Cancer Cells.
26718429 2015 Genetic variants in the tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) do not contribute but Death Receptor (DR4) genes may contribute to susceptibility to head and neck cancer in Pakistani population.
26648023 2016 Gambogic acid induces apoptosis and sensitizes TRAIL-mediated apoptosis through downregulation of cFLIPL in renal carcinoma Caki cells.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
More...