Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
R01 Count 2
Funding $83,880.88
PubMed Score 18.75
PubTator Score 16.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -1.991 0.000
lung cancer 1.600 0.001
inflammatory breast cancer -1.200 0.005

Synonym

Accession P50583 D3DRM0 Q5T589
Symbols APAH1

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

1XSA   1XSB   1XSC   3U53   4ICK   4IJX  

Gene RIF (6)

PMID Text
23384440 This paper presents the crystal structure of wild-type and E58A mutant human Ap4A hydrolase.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20533549 High NUDT2 is associated with breast carcinoma.
20144233 In this study the authors present data demonstrating that the SARS-CoV 7a protein interacts with human Ap4A-hydrolase (asymmetrical diadenosine tetraphosphate hydrolase, EC 3.6.1.17).
15772762 NMR resonance assignments
15596429 crystallographic structure and substrate-binding mechanism of Ap4A hydrolase

AA Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL      1 - 70
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ     71 - 140
FLCSIEA                                                                   141 - 147
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23384440 2013 Crystal structure of wild-type and mutant human Ap4A hydrolase.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20533549 2011 Nudix-type motif 2 in human breast carcinoma: a potent prognostic factor associated with cell proliferation.
20144233 2010 SARS coronavirus protein 7a interacts with human Ap4A-hydrolase.
15772762 2005 1H, 13C, and 15N resonance assignments of the 17 kDa Ap4A hydrolase from Homo sapiens in the presence and absence of ATP.
15596429 2005 Structure and substrate-binding mechanism of human Ap4A hydrolase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...