Property Summary

NCBI Gene PubMed Count 25
PubMed Score 18.38
PubTator Score 16.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
osteosarcoma 7950 3.4e-05
psoriasis 6694 5.7e-05
lung cancer 4740 7.2e-04
inflammatory breast cancer 286 4.7e-03
Disease Target Count Z-score Confidence
cartilage-hair hypoplasia 7 4.231 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
inflammatory breast cancer -1.200 4.7e-03
lung cancer 1.600 7.2e-04
osteosarcoma -1.991 3.4e-05
psoriasis -2.100 5.7e-05

Gene RIF (8)

AA Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL      1 - 70
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ     71 - 140
FLCSIEA                                                                   141 - 147
//

Text Mined References (27)

PMID Year Title