Property Summary

NCBI Gene PubMed Count 45
Grant Count 43
R01 Count 29
Funding $7,073,964.93
PubMed Score 91.80
PubTator Score 86.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26935506 Suggest MetAP2 as important regulator of proliferation/apoptosis in non-small cell lung cancers.
25886145 Nt-acetylation prevents the excision of the initiator methionine by MetAP2.
24700462 Data indicate that methionine aminopeptidase 2 (MetAP2) contains a single disulfide bond that exists in oxidized and reduced states and influences enzyme function.
24041691 The activity of unmodified, nitrated and oxidised METAP2 was assessed and it was found that nitration significantly reduced its ability to cleave a chromogenic substrate. Mass spectrometry analysis identified Tyr336 as a nitrated residue in METAP2.
23161775 Increased expression of METAP2 is associated with pilocytic astrocytoma.
21937698 This study demonstrated a hitherto-undescribed role of MetAP2 in definitive hematopoiesis and a possible link to noncanonical Wnt and ERK signaling.
20689807 Observational study of gene-disease association. (HuGE Navigator)
20521764 the substrate specificities of Escherichia coli MetAP1, human MetAP1, and human MetAP2 were systematically profiled
19703310 Data indicate that MetAP2 expression and pp60c-src phosphorylation were decreased in NC2213 treated cells.
18828628 Discovery, identification, and characterization of candidate pharmacodynamic markers of METAP2 inhibition are reported.
More...

AA Sequence

MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKESGASVDEVARQ      1 - 70
LERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPT     71 - 140
QDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKE    141 - 210
NGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAV    211 - 280
KDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGG    281 - 350
EATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL    351 - 420
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY                421 - 478
//

Text Mined References (60)

PMID Year Title
26935506 Methionine Aminopeptidase 2 as a Potential Therapeutic Target for Human Non-Small-Cell Lung Cancers.
25886145 2015 N-terminal acetylome analysis reveals the specificity of Naa50 (Nat5) and suggests a kinetic competition between N-terminal acetyltransferases and methionine aminopeptidases.
24700462 2014 Redox regulation of methionine aminopeptidase 2 activity.
24611021 2014 Inhibition of the methionine aminopeptidase 2 enzyme for the treatment of obesity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24041691 2013 Tyrosine nitration moderates the peptidase activity of human methionyl aminopeptidase 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161775 2013 MicroRNA profiling in pediatric pilocytic astrocytoma reveals biologically relevant targets, including PBX3, NFIB, and METAP2.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21937698 2011 Methionine aminopeptidase 2 is required for HSC initiation and proliferation.
More...