Property Summary

NCBI Gene PubMed Count 148
PubMed Score 1426.11
PubTator Score 256.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.920 1.4e-06
glioblastoma 1.200 2.2e-05

 GWAS Trait (2)

Gene RIF (105)

PMID Text
26791826 We conclude that DNM2 is a novel negative regulator of NO production in mouse collecting ducts.
26517984 exome sequencing family study reveals that autosomal dominant spastic paraplegia linked to a GTPase-effector domain mutation of dynamin 2
26503427 results provide evidence for a novel Arf6 activation mechanism by Dyn2 through EFA6B and EFA6D in CME in a manner dependent upon the GTPase activity of Dyn2
26475677 uncover a link between the dynamin 2 function and JNK signaling which leads to AP-1 induction
26413867 Dynamin 2 deletion in beta cells caused glucose intolerance and reduced the 2d phase of glucose-stimulated insulin secretion. Dynamin 2 regulates insulin secretory capacity and dynamics in vivo via a mechanism depending on CME and F-actin remodeling.
25982272 In marked contrast to invadopodia, this degradation does not require the action of Src kinase, Cdc42 or Dyn2. Rather, inhibition of Dyn2 causes a marked upregulation of stromal matrix degradation
25957634 This study demonistrated that DNM2 mutation releated to Centronuclear myopathy.
25501959 this study described for the first time the clinical, pathological and genetic features of DNM2-related CNM in Chinese patients.
25336256 Thus dynamin that was recently found to control late stages of myoblast fusion also controls late stages of macrophage fusion, revealing an intriguing conserved mechanistic motif shared by diverse cell-cell fusion processes.
25263585 Data indicate that dynamin 2 (Dyn2) interacts with Connexin 26 (Cx26) in a yeast two-hybrid screen, and co-localizes in mammalian cells.
25232009 Dynamin 2 is recruited as dimers during endocytic membrane scission at the neck of a clathrin-coated pit.
25116793 Dynamin 1 and dynamin 2 activity are not essential for Chlamydia trachomatis internalization but is required for normal development.
25061227 These results reveal that girdin regulates selective clathrin-mediated endocytosis via a mechanism involving dynamin 2, but not by operating as a cargo-specific adaptor.
24970086 findings show NDPKs (NM23-H1/H2/H4) interact with and provide GTP to dynamins, allowing these motor proteins to work with high thermodynamic efficiency for membrane remodeling
24891602 dynamin2 recruitment is regulated by actin polymerization
24848261 FGF21 has a role in promoting endothelial cell angiogenesis through a dynamin-2 and Rab5 dependent pathway
24809731 Upon overexpression of dynamin-2 mutants or depletion of clathrin heavy chain, flotillins are permanently trapped in endosomes.
24706848 results demonstrate a regulatory relationship between DNM2, miR-199a, and HIF, with implications in cancer metastasis
24402972 Inhibition of Dyn2 prevents cell invasiveness in androgen-responsive and -refractory PCA models, supporting the potential benefit of Dyn2 to serve as a therapeutic target for advanced prostate cancer .
24145164 These findings provide new evidence for the participation of the autolysosome in hepatocyte lipid droplet metabolism and demonstrate a novel role for dynamin2 in the function and maturation of an autophagic compartment.
24016602 A mutation associated with centronuclear myopathy enhances the size and stability of dynamin 2 complexes.
23891661 We identify dynamin and the EAP-binding alpha-adaptin appendage domain of the AP2 adaptor as switches in a regulated, multistep maturation process and provide direct evidence for a molecular checkpoint in clathrin mediated endocytosis.
23861397 Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.
23851497 Results indicate that hSNF5 affects both the stability and the activity of DNM2, uncovering an unexpected role of hSNF5 in modulating endocytosis, and open new perspectives in understanding the role of hSNF5 in tumour genesis.
23678185 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23537630 study provides evidence the large GTPase Dyn2 regulates the small GTPase Rac1 to potentiate invasive migration of pancreatic tumor cells; Dyn2 plays an essential role in regulating Rac1-mediated pancreatic tumor cell migration through modulation of the Rac1 activator Vav1 via a direct interaction
23394783 Three novel DNM2 mutations in an Italy cohort of centronuclear myopathy patients.
23374900 This mutation (D614N) within the DNM2 gene in a large centronuclear myopathy family with a late age of overt clinical manifestation caused profound changes in DNM2 localization and impaired proper organization of myofibers and skeletal muscle function.
23170932 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23092955 The first homozygous mutation in the DNM2 protein p.Phe379Val, in three consanguineous patients with a lethal congenital syndrome, is reported.
22959143 investigation of dynamin 2 expression in cervix of patients with suspected cervical intraepithelial neoplasia; evaluation of dynamin 2 expression as biological marker in diagnosis/staging/grading of cervical intraepithelial neoplasia
22924779 New onset strabismus and a history of a myopathy should consider this entity in the differential diagnosis that could be confirmed by a muscle biopsy and mutational analysis.
22846998 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22613877 clinicopathological features of DNM2 centronuclear myopathy are rather homogeneous and can be distinguished from the features of non-DNM2 centronuclear myopathy
22574813 Dynamin II function is required for EGF-mediated Stat3 activation but not Erk1/2 phosphorylation
22528500 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22396310 Defects in membrane trafficking due to DNM2 mutations potentially represent a common pathological mechanism in CNM and CMT.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174845 The alteration of microtubules by dynamin2 depletion reduced the length and the speed of the actin comet.
22103831 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22096584 The mild functional defects are suggestive of differences between CMT and CNM disease-causing dynamin 2 mutants and suggest that a slight impairment in clathrin-mediated pathways may accumulate over time to foster the respective human diseases.
22091729 DNM2 mutations cause autosomal dominant centronuclear myopathy or autosomal dominant (AD) Charcot-Marie-Tooth (CMT) disease; one large Czech family with 15 members affected with an AD CMT phenotype of extraordinary variability is reported.
22082156 Knockdown of dynamin 2 (DNM2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
22022388 Dynamin 2/NPRAP colocalization and direct interaction in vivo, was investigated.
21996738 this study identifies Dyn2 as an effector that mediates PDGFRalpha-SHP-2-induced glioma tumor growth and invasion
21841817 tumor cells overexpressing Dyn2 protruded lamellipodia at twice the rate, migrated faster (180%) and farther (2.5-fold greater distance) on glass and through transwell chambers
21813615 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21514436 DNM2 plays important roles in the maintenance of adult muscle fibers
21411625 This study defines a novel mechanism of how Dyn2 functions as a downstream effector of FAK-Src signaling in turning over focal adhesions.
21338326 In summary, these results suggested that dynamin 2 might play a role in HIV-1 Env-mediated cell-cell fusion.
21338326 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21283621 Ndel1 regulates Dyn2 GTPase activity and impacts GluR1-containing membranes distribution in a manner reminiscent of Dyn2.
21221624 The phenotype in DNM2-CNM cases seem to be broader than previously thought and often includes patients with de novo mutations, neonatal onset, unusual contractures and restrictive lung impairment
21220511 eNOS-dependent dynamin2 S-nitrosylation and invasion of host cells to cause recurrent urinary tract infections.
21195118 Phosphorylation of dynamin II primarily occurs on a single site that regulates cytokinesis downstream of calcineurin, rather than regulating endocytosis or centrosome function.
21150131 The deletion of PRD domain of dynamin 2 resulted in the impairment of both the localization and the abscission of daughter cells.
21135248 {alpha}V{beta}3-integrin routes herpes simplex virus to an entry pathway dependent on cholesterol-rich lipid rafts and dynamin2.
20822789 The authors conclude that the second extracellular loop of occludin dictates the Dynamin 2-dependent hepatitis C virus entry.
20638642 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20594957 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20574164 results suggest dynamin 2 might be involved in preventing tumor invasion and lymph node metastasis, possibly in relation with extracellular matrix degradation; may be a prognostic marker for these risk factors in early cervical squamous cell carcinoma
20508983 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20397975 Data confirm that inhibition of dyamin-2 induces leakiness in the endothelial monolayer by increasing the load of peroxynitrite under hypoxia.
20227276 We report a series of 12 patients from eight families with CNM in whom we have identified a number of novel features that expand the reported clinicopathological phenotype. We identified two novel and five recurrent missense mutations in DNM2.
20089652 Internalization of coxsackievirus A9 is mediated by {beta}2-microglobulin, dynamin, and Arf6.
19932619 DNM2 mutation leading to neonatal onset of centronuclear myopathy follows a course similar to adult-onset cases
19833721 These results suggest that hyperoxia induces caveolin-1-dependent, c-Abl-mediated dynamin 2 phosphorylation required for recruitment of p47(phox) to caveolin-enriched microdomains and subsequent ROS production in lung endothelium.
19623537 impairment of clathrin-mediated endocytosis may play a role in the pathophysiological mechanisms leading to DNM2-related diseases, but the tissue-specific impact of DNM2 mutations in both diseases remains unclear
19528294 Results suggest that dynamin 2 regulates dynamic instability of microtubules, which is essential for organelle motility, and that this function may be impaired in Charcot-Marie-Tooth disease.
19502294 dynamin 2 mutations should be screened in the autosomal dominant Charcot-Marie-Tooth neuropathy families with intermediate or axonal NCV, and in patients with a classical mild to moderately severe Charcot-Marie-Tooth phenotype.
19331814 These results provide a first evidence for a regulated interaction of dynamin-2 with microtubules in cultured mammalian cells.
19155218 formin-binding protein 17 (FBP17) recruits WASP, WASP-interacting protein (WIP), and dynamin-2 to the plasma membrane and that this recruitment is necessary for the formation of podosomes and phagocytic cups.
19126407 These data suggest that DNM2 expression is reduced in late-onset Alzheimer's disease , which results in the accumulation of APP in lipid raft-rich plasma membranes.
19122038 report a novel DNM2 CNM mutation in the CMT region. Among the DNM2-related CNM, the phenotype appears intermediate, with an onset at the end of the first decade and a more rapid progression relative to the mild late-onset DNM2-CNM.
18981119 These findings identify a novel role for Dynamin 2 in the exocytic events required for effective NK cell-mediated cytotoxicity.
18854154 Knockdown of dynamin 2 (DNM2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18817572 REVIEW : DNM2 mutations and centronuclear myopathy
18715908 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18602423 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18560793 MR imaging study accurately depicts lower limb muscle involvement in CMT2 caused by DNM2 mutation.
18541215 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18394888 we report a novel DNM2 mutation in the Pleckstrin homology domain of DNM2 (p.K559del) in a patient with an axonal length-dependent sensorimotor polyneuropathy predominantly affecting the lower limbs.
18236001 Dynamin 2 gene is a novel susceptibility gene for late-onset Alzheimer disease in non-APOE-epsilon4 carriers.
18236001 Observational study of gene-disease association. (HuGE Navigator)
18003703 DNM2 mediates fluid-phase micropinocytosis in epithelial cells.
17932957 Four heterozygous dynamin 2 (DNM2) mutations in five centronuclear myopathy patients aged 1 to 15 years.
17825552 This study suggests that the phenotypes of dynamin 2 related centronuclear myopathy and Charcot-Marie-Tooth disease overlap and that DNM2 mutations may alter cerebral function.
17702746 CD44 is an important regulator of HGF/c-Met-mediated in vitro and in vivo barrier enhancement, a process with essential involvement of Tiam1, Rac1, dynamin 2, and cortactin.
17702744 myoferlin forms a complex with dynamin-2 and VEGFR-2, which prevents CBL-dependent VEGFR-2 polyubiquitination and proteasomal degradation.
17636067 DNM2 has an etiologic role in axonal Charcot-Marie-Tooth disease type 2 neuropathy.
17626097 HPV type 31 (HPV31) entry and initiation of early infection events require both caveolin 1 and dynamin 2 and occur independently of clathrin-mediated endocytosis.
17565002 DNM2 reglates riboflavin endocytosis in human placental trophoblasts.
17412836 Dyn2 is a Nef-associated protein required for the infectivity enhancement of progeny virions by Nef.
17412836 Tandem affinity purification and mass spectrometry analysis identify dynamin 2 (DNM2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16556602 dynamin has roles in the IL-5 signaling pathway and in receptor endocytosis and termination of the ERK1/2 signaling pathway
16551695 Thus, syndapin-dynamin complexes are crucial and sufficient to promote vesicle formation from the trans-Golgi network.
16227997 Missense mutations in dynamin 2 is associated with dominant centronuclear myopathy
16049137 dynamin-2 regulates KDR expression and function and plays an important role in VPF/VEGF mediated angiogenesis
15731758 Mutations in the PH domain of dynamin 2 is associated with dominant intermediate Charcot-Marie-Tooth neuropathy (DI-CMTB)
15545517 Dynamin-2 at least partially regulated oxLDL-induced apoptosis of VSMC by participating in 2 independent pathways: the oxLDL endocytotic pathway and the p53 pathway.
15299020 dynamin-2 membrane recruitment is mediated by sorting nexin 9
12668728 dynamin2 and Rab5 have roles in endocytosis of lysophosphatidic acid-coupled LPA1/EDG-2 receptors
11782545 These findings suggest that dynamin is part of a protein network that controls nucleation of actin from membranes.

AA Sequence

MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLI      1 - 70
LQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGI     71 - 140
TKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKT    211 - 280
LNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQ    281 - 350
VDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL    351 - 420
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNH    421 - 490
EDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKE    491 - 560
KKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKD    561 - 630
QAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLY    631 - 700
SSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRR    701 - 770
PVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPP    771 - 840
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD                                            841 - 870
//

Text Mined References (158)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26791826 2016 Dynamin-2 is a novel NOS1? interacting protein and negative regulator in the collecting duct.
26517984 2015 Adult-onset autosomal dominant spastic paraplegia linked to a GTPase-effector domain mutation of dynamin 2.
26503427 2015 Activation of the Small G Protein Arf6 by Dynamin2 through Guanine Nucleotide Exchange Factors in Endocytosis.
26475677 2016 Impaired dynamin 2 function leads to increased AP-1 transcriptional activity through the JNK/c-Jun pathway.
26413867 2015 Dynamin 2 regulates biphasic insulin secretion and plasma glucose homeostasis.
25982272 2016 Stromal fibroblasts facilitate cancer cell invasion by a novel invadopodia-independent matrix degradation process.
25957634 2015 Centronuclear myopathies: genotype-phenotype correlation and frequency of defined genetic forms in an Italian cohort.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501959 2015 Clinical, pathological, and genetic features of dynamin-2-related centronuclear myopathy in China.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25336256 2014 Late stages of the synchronized macrophage fusion in osteoclast formation depend on dynamin.
25263585 2014 Dynamin 2 interacts with connexin 26 to regulate its degradation and function in gap junction formation.
25232009 2014 Dynamin recruitment and membrane scission at the neck of a clathrin-coated pit.
25116793 2014 Dynamin-mediated lipid acquisition is essential for Chlamydia trachomatis development.
25061227 2014 Regulation of cargo-selective endocytosis by dynamin 2 GTPase-activating protein girdin.
24970086 2014 Membrane trafficking. Nucleoside diphosphate kinases fuel dynamin superfamily proteins with GTP for membrane remodeling.
24891602 2014 Actin and dynamin2 dynamics and interplay during clathrin-mediated endocytosis.
24848261 2014 FGF21 promotes endothelial cell angiogenesis through a dynamin-2 and Rab5 dependent pathway.
24809731 2014 Role of dynamin and clathrin in the cellular trafficking of flotillins.
24706848 2014 Dynamin 2 along with microRNA-199a reciprocally regulate hypoxia-inducible factors and ovarian cancer metastasis.
24402972 2014 The significance of dynamin 2 expression for prostate cancer progression, prognostication, and therapeutic targeting.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145164 2013 Lipid droplet breakdown requires dynamin 2 for vesiculation of autolysosomal tubules in hepatocytes.
24016602 2014 A mutation associated with centronuclear myopathy enhances the size and stability of dynamin 2 complexes in cells.
23891661 2013 Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.
23861397 2013 Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.
23851497 2014 Cytoplasmic interaction of the tumour suppressor protein hSNF5 with dynamin-2 controls endocytosis.
23537630 2013 Dynamin 2 potentiates invasive migration of pancreatic tumor cells through stabilization of the Rac1 GEF Vav1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23394783 2013 Centronuclear myopathy related to dynamin 2 mutations: clinical, morphological, muscle imaging and genetic features of an Italian cohort.
23374900 2013 A novel mutation in the DNM2 gene impairs dynamin 2 localization in skeletal muscle of a patient with late onset centronuclear myopathy.
23092955 2013 Dynamin 2 homozygous mutation in humans with a lethal congenital syndrome.
22959143 2012 Dynamin 2 expression as a biomarker in grading of cervical intraepithelial neoplasia.
22924779 Histopathologic changes in the extraocular muscle in centronuclear myopathy with a Dynamin 2 mutation.
22623184 2012 Molecular and structural characterization of the SH3 domain of AHI-1 in regulation of cellular resistance of BCR-ABL(+) chronic myeloid leukemia cells to tyrosine kinase inhibitors.
22613877 2012 Clinicopathological features of centronuclear myopathy in Japanese populations harboring mutations in dynamin 2.
22574813 2012 Dynamin II function is required for EGF-mediated Stat3 activation but not Erk1/2 phosphorylation.
22528500 2012 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22396310 2012 Mutation spectrum in the large GTPase dynamin 2, and genotype-phenotype correlation in autosomal dominant centronuclear myopathy.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22174845 2011 Disruption of microtubule network rescues aberrant actin comets in dynamin2-depleted cells.
22096584 2011 Mild functional differences of dynamin 2 mutations associated to centronuclear myopathy and Charcot-Marie Tooth peripheral neuropathy.
22091729 2011 Phenotypic variability in a large Czech family with a dynamin 2-associated Charcot-Marie-Tooth neuropathy.
22022388 2011 Identification of novel NPRAP/?-catenin-interacting proteins and the direct association of NPRAP with dynamin 2.
21996738 2012 Dynamin 2 mediates PDGFR?-SHP-2-promoted glioblastoma growth and invasion.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21841817 2012 Increased expression of the large GTPase dynamin 2 potentiates metastatic migration and invasion of pancreatic ductal carcinoma.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21514436 2011 Increased expression of wild-type or a centronuclear myopathy mutant of dynamin 2 in skeletal muscle of adult mice leads to structural defects and muscle weakness.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21411625 2011 A direct interaction between the large GTPase dynamin-2 and FAK regulates focal adhesion dynamics in response to active Src.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21338326 2011 The role of dynamin in HIV type 1 Env-mediated cell-cell fusion.
21283621 2011 The cytoskeletal protein Ndel1 regulates dynamin 2 GTPase activity.
21269460 2011 Initial characterization of the human central proteome.
21221624 2011 Phenotype variability and histopathological findings in centronuclear myopathy due to DNM2 mutations.
21220511 2011 Dynamin2- and endothelial nitric oxide synthase-regulated invasion of bladder epithelial cells by uropathogenic Escherichia coli.
21195118 2011 Phosphorylation of dynamin II at serine-764 is associated with cytokinesis.
21150131 2011 Dynamin 2 associates with microtubules at mitosis and regulates cell cycle progression.
21135248 2010 {alpha}V{beta}3-integrin routes herpes simplex virus to an entry pathway dependent on cholesterol-rich lipid rafts and dynamin2.
20822789 2010 The second extracellular loop dictates Occludin-mediated HCV entry.
20711168 2010 A Dyn2-CIN85 complex mediates degradative traffic of the EGFR by regulation of late endosomal budding.
20574164 2010 Low dynamin 2 expression is associated with tumor invasion and metastasis in invasive squamous cell carcinoma of cervix.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20397975 2010 Inhibition of dynamin-2 confers endothelial barrier dysfunctions by attenuating nitric oxide production.
20227276 2010 Expanding the clinical, pathological and MRI phenotype of DNM2-related centronuclear myopathy.
20089652 2010 Internalization of coxsackievirus A9 is mediated by {beta}2-microglobulin, dynamin, and Arf6 but not by caveolin-1 or clathrin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19932620 2010 Centronuclear myopathy with cataracts due to a novel dynamin 2 (DNM2) mutation.
19932619 2010 Adult course in dynamin 2 dominant centronuclear myopathy with neonatal onset.
19833721 2009 Dynamin 2 and c-Abl are novel regulators of hyperoxia-mediated NADPH oxidase activation and reactive oxygen species production in caveolin-enriched microdomains of the endothelium.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19623537 2009 Dynamin 2 mutations associated with human diseases impair clathrin-mediated receptor endocytosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19528294 2009 Dynamic instability of microtubules requires dynamin 2 and is impaired in a Charcot-Marie-Tooth mutant.
19502294 2009 Phenotypic spectrum of dynamin 2 mutations in Charcot-Marie-Tooth neuropathy.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19331814 2009 New function of the proline rich domain in dynamin-2 to negatively regulate its interaction with microtubules in mammalian cells.
19155218 2009 FBP17 Mediates a Common Molecular Step in the Formation of Podosomes and Phagocytic Cups in Macrophages.
19126407 2009 Decrease of dynamin 2 levels in late-onset Alzheimer's disease alters Abeta metabolism.
19122038 2009 A new centronuclear myopathy phenotype due to a novel dynamin 2 mutation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18981119 2008 Dynamin 2 regulates granule exocytosis during NK cell-mediated cytotoxicity.
18817572 2008 Centronuclear (myotubular) myopathy.
18806795 2008 A canine DNM1 mutation is highly associated with the syndrome of exercise-induced collapse.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18560793 2008 Magnetic resonance imaging findings of leg musculature in Charcot-Marie-Tooth disease type 2 due to dynamin 2 mutation.
18480402 2008 The PCH family member proline-serine-threonine phosphatase-interacting protein 1 targets to the leukocyte uropod and regulates directed cell migration.
18394888 2008 A novel mutation in the dynamin 2 gene in a Charcot-Marie-Tooth type 2 patient: clinical and pathological findings.
18388313 2008 SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.
18353773 2008 A novel sorting nexin modulates endocytic trafficking and alpha-secretase cleavage of the amyloid precursor protein.
18236001 2008 Dynamin 2 gene is a novel susceptibility gene for late-onset Alzheimer disease in non-APOE-epsilon4 carriers.
18003703 2007 Dynamin 2 mediates fluid-phase micropinocytosis in epithelial cells.
17932957 2007 Dynamin 2 mutations cause sporadic centronuclear myopathy with neonatal onset.
17825552 2007 Subtle central and peripheral nervous system abnormalities in a family with centronuclear myopathy and a novel dynamin 2 gene mutation.
17702746 2007 CD44 regulates hepatocyte growth factor-mediated vascular integrity. Role of c-Met, Tiam1/Rac1, dynamin 2, and cortactin.
17702744 2007 Myoferlin regulates vascular endothelial growth factor receptor-2 stability and function.
17636067 2007 Two novel mutations in dynamin-2 cause axonal Charcot-Marie-Tooth disease.
17626097 2007 Human papillomavirus type 31 uses a caveolin 1- and dynamin 2-mediated entry pathway for infection of human keratinocytes.
17565002 2007 Dynamin 2 regulates riboflavin endocytosis in human placental trophoblasts.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17412836 2007 Dynamin 2 is required for the enhancement of HIV-1 infectivity by Nef.
17257598 2007 Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16696976 2006 Two mechanistically distinct forms of endocytosis in adrenal chromaffin cells: Differential effects of SH3 domains and amphiphysin antagonism.
16636290 2006 Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
16556602 2006 Differential regulation of interleukin 5-stimulated signaling pathways by dynamin.
16551695 2006 Complexes of syndapin II with dynamin II promote vesicle formation at the trans-Golgi network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16325581 2005 TTP specifically regulates the internalization of the transferrin receptor.
16234328 2005 NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS.
16227997 2005 Mutations in dynamin 2 cause dominant centronuclear myopathy.
16049137 2005 Regulatory role of dynamin-2 in VEGFR-2/KDR-mediated endothelial signaling.
15895076 2005 Microtubule-induced focal adhesion disassembly is mediated by dynamin and focal adhesion kinase.
15834155 2005 Kinetics of Src homology 3 domain association with the proline-rich domain of dynamins: specificity, occlusion, and the effects of phosphorylation.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15731758 2005 Mutations in the pleckstrin homology domain of dynamin 2 cause dominant intermediate Charcot-Marie-Tooth disease.
15703209 2005 SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.
15696170 2005 Dynamin 2 regulates T cell activation by controlling actin polymerization at the immunological synapse.
15545517 2004 Dynamin-2 regulates oxidized low-density lipoprotein-induced apoptosis of vascular smooth muscle cell.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483625 2004 Regulation of Bin1 SH3 domain binding by phosphoinositides.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15299020 2004 Regulated membrane recruitment of dynamin-2 mediated by sorting nexin 9.
15252009 2004 A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14985334 2004 Analysis of clathrin-mediated endocytosis of epidermal growth factor receptor by RNA interference.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12668728 2003 Agonist-induced endocytosis of lysophosphatidic acid-coupled LPA1/EDG-2 receptors via a dynamin2- and Rab5-dependent pathway.
12517701 2003 Dynamin at the actin-membrane interface.
12511974 2002 Dynamin: characteristics, mechanism of action and function.
12498685 2002 The large GTPase dynamin associates with the spindle midzone and is required for cytokinesis.
12481986 2002 Reduction in the minimum candidate interval in the dominant-intermediate form of Charcot-Marie-Tooth neuropathy to D19S586 to D19S432.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456676 2003 Characterization of Endophilin B1b, a brain-specific membrane-associated lysophosphatidic acid acyl transferase with properties distinct from endophilin A1.
12419186 2002 Dynamin2 and cortactin regulate actin assembly and filament organization.
12383797 2002 Dynamin and endocytosis.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11782545 2002 Dynamin at actin tails.
11583995 2001 Dynamin isoform-specific interaction with the shank/ProSAP scaffolding proteins of the postsynaptic density and actin cytoskeleton.
11533912 2001 Dominant intermediate Charcot-Marie-Tooth neuropathy maps to chromosome 19p12-p13.2.
11502744 2001 The inhibitory gamma subunit of the type 6 retinal cyclic guanosine monophosphate phosphodiesterase is a novel intermediate regulating p42/p44 mitogen-activated protein kinase signaling in human embryonic kidney 293 cells.
11483962 2001 The Eps15 C. elegans homologue EHS-1 is implicated in synaptic vesicle recycling.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10893263 2000 Evidence that dynamin-2 functions as a signal-transducing GTPase.
10542231 1999 The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.
10477567 1999 Characterization of RANTES- and aminooxypentane-RANTES-triggered desensitization signals reveals differences in recruitment of the G protein-coupled receptor complex.
10101292 1999 Dynamin II is involved in endocytosis but not in the formation of transport vesicles from the trans-Golgi network.
9143510 1997 Dynamin genes Dnm1 and Dnm2 are located on proximal mouse chromosomes 2 and 9, respectively.
7590285 1995 Isolation of an ubiquitously expressed cDNA encoding human dynamin II, a member of the large GTP-binding protein family.