Property Summary

NCBI Gene PubMed Count 148
Grant Count 698
R01 Count 458
Funding $91,695,400.67
PubMed Score 1426.11
PubTator Score 256.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.920 0.000
glioblastoma 1.200 0.000

Synonym

Accession P50570 A8K1B6 E7EV30 E9PEQ4 K7ESI9 Q5I0Y0 Q7Z5S3 Q9UPH4
Symbols DYN2
CMT2M
DYNII
LCCS5
CMTDI1
CMTDIB
DI-CMTB

Gene

PDB

2YS1  

 GWAS Trait (2)

Gene RIF (111)

PMID Text
26791826 We conclude that DNM2 is a novel negative regulator of NO production in mouse collecting ducts.
26517984 exome sequencing family study reveals that autosomal dominant spastic paraplegia linked to a GTPase-effector domain mutation of dynamin 2
26503427 results provide evidence for a novel Arf6 activation mechanism by Dyn2 through EFA6B and EFA6D in CME in a manner dependent upon the GTPase activity of Dyn2
26475677 uncover a link between the dynamin 2 function and JNK signaling which leads to AP-1 induction
26413867 Dynamin 2 deletion in beta cells caused glucose intolerance and reduced the 2d phase of glucose-stimulated insulin secretion. Dynamin 2 regulates insulin secretory capacity and dynamics in vivo via a mechanism depending on CME and F-actin remodeling.
25982272 In marked contrast to invadopodia, this degradation does not require the action of Src kinase, Cdc42 or Dyn2. Rather, inhibition of Dyn2 causes a marked upregulation of stromal matrix degradation
25957634 This study demonistrated that DNM2 mutation releated to Centronuclear myopathy.
25501959 this study described for the first time the clinical, pathological and genetic features of DNM2-related CNM in Chinese patients.
25336256 Thus dynamin that was recently found to control late stages of myoblast fusion also controls late stages of macrophage fusion, revealing an intriguing conserved mechanistic motif shared by diverse cell-cell fusion processes.
25263585 Data indicate that dynamin 2 (Dyn2) interacts with Connexin 26 (Cx26) in a yeast two-hybrid screen, and co-localizes in mammalian cells.
More...

AA Sequence

MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLI      1 - 70
LQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGI     71 - 140
TKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKT    211 - 280
LNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQ    281 - 350
VDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL    351 - 420
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNH    421 - 490
EDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKE    491 - 560
KKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKD    561 - 630
QAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLY    631 - 700
SSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRR    701 - 770
PVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPP    771 - 840
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD                                            841 - 870
//

Text Mined References (158)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26791826 2016 Dynamin-2 is a novel NOS1? interacting protein and negative regulator in the collecting duct.
26517984 2015 Adult-onset autosomal dominant spastic paraplegia linked to a GTPase-effector domain mutation of dynamin 2.
26503427 2015 Activation of the Small G Protein Arf6 by Dynamin2 through Guanine Nucleotide Exchange Factors in Endocytosis.
26475677 2016 Impaired dynamin 2 function leads to increased AP-1 transcriptional activity through the JNK/c-Jun pathway.
26413867 2015 Dynamin 2 regulates biphasic insulin secretion and plasma glucose homeostasis.
25982272 2016 Stromal fibroblasts facilitate cancer cell invasion by a novel invadopodia-independent matrix degradation process.
25957634 2015 Centronuclear myopathies: genotype-phenotype correlation and frequency of defined genetic forms in an Italian cohort.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501959 2015 Clinical, pathological, and genetic features of dynamin-2-related centronuclear myopathy in China.
More...