Property Summary

NCBI Gene PubMed Count 80
PubMed Score 277.62
PubTator Score 198.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Haddad syndrome 3

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.100 1.4e-02
Astrocytoma, Pilocytic 2.900 3.7e-10
atypical teratoid/rhabdoid tumor 1.400 1.5e-02
ependymoma 1.500 1.5e-02
glioblastoma 1.500 2.2e-02
group 4 medulloblastoma -2.200 8.5e-04
head and neck cancer and chronic obstruc... -1.400 4.8e-02
lung cancer 4.200 3.6e-07
lung carcinoma 3.700 8.8e-16
medulloblastoma, large-cell -3.300 1.3e-06
non-small cell lung cancer and chronic o... -1.400 3.4e-02
oligodendroglioma 1.100 4.2e-02
osteosarcoma 1.092 5.3e-03
ovarian cancer -1.700 9.7e-07
pediatric high grade glioma 1.800 2.7e-03
pituitary cancer -3.500 3.3e-04
primitive neuroectodermal tumor 1.800 5.6e-04
psoriasis 1.200 5.1e-04
subependymal giant cell astrocytoma -1.331 4.5e-02

Gene RIF (61)

AA Sequence

MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA      1 - 70
DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT     71 - 140
LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS    141 - 210
SYSSDEGSYDPLSPEEQELLDFTNWF                                                211 - 236
//

Text Mined References (81)

PMID Year Title