Property Summary

NCBI Gene PubMed Count 136
Grant Count 323
R01 Count 209
Funding $37,561,019.84
PubMed Score 882.96
PubTator Score 458.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P50552 B2RBT9 Q6PIZ1 Q93035 VASP
Symbols

Gene

PDB

1EGX   1JNG   1USD   1USE   2PAV   2PBD   3CHW  

Gene RIF (85)

PMID Text
26611125 VASP, zyxin and TES are tension-dependent members of focal adherens junctions independent of the alpha-catenin-vinculin module.
26336132 Data show that the phosphorylation status of vasodilator-stimulated phosphoprotein (VASP) at serine S322 can be predictive for breast cancer progression to an aggressive phenotype.
26295568 The authors propose that Lpd delivers Ena/VASP proteins to growing barbed ends and increases their actin polymerase activity by tethering them to actin filaments.
25759389 VASP phosphorylation at Ser(157) mediates its localization at the membrane, but that VASP Ser(157) phosphorylation and membrane localization are not sufficient to activate its actin catalytic activity
25543053 Serine phosphorylation of vasodilator-stimulated phosphoprotein (VASP) regulates colon cancer cell survival and apoptosis.
25457586 In clinical practice,LCR and CYP2C19 gene polymorphism should be assessed in NCIS patients receiving clopidogrel treatment.
25355952 Ena/VASP's ability to bind F-actin and profilin-complexed G-actin are important for its effect, whereas Ena/VASP tetramerization is not necessary.
25298072 The authors demonstrate that vasodilator-stimulated phosphoprotein (VASP), which is critical for regulation of actin assembly, cell adhesion and motility, is a direct substrate of Yersinia pestis YpkA kinase activity.
25246528 VASP reconstitution of actin-based motility depends on the recruitment of F-actin seeds from the solution produced by cofilin
25117404 Overexpression of VASP in endothelial cells blocked inflammation and insulin resistance induced by palmitate.
More...

AA Sequence

MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGV      1 - 70
KYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQ     71 - 140
QKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPL    141 - 210
PAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQV    211 - 280
GEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQE    281 - 350
LLEEVKKELQKVKEEIIEAFVQELRKRGSP                                            351 - 380
//

Text Mined References (152)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26611125 2015 VASP, zyxin and TES are tension-dependent members of Focal Adherens Junctions independent of the ?-catenin-vinculin module.
26336132 2015 The phosphorylation status of VASP at serine 322 can be predictive for aggressiveness of invasive ductal carcinoma.
26295568 2015 Lamellipodin promotes actin assembly by clustering Ena/VASP proteins and tethering them to actin filaments.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25759389 2015 Vasodilator-stimulated phosphoprotein (VASP) regulates actin polymerization and contraction in airway smooth muscle by a vinculin-dependent mechanism.
25543053 2015 Serine phosphorylation of vasodilator-stimulated phosphoprotein (VASP) regulates colon cancer cell survival and apoptosis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25457586 2014 VASP phosphorylation and genetic polymorphism for clopidogrel resistance in Chinese patients with non-cardioembolic ischemic stroke.
25416956 2014 A proteome-scale map of the human interactome network.
More...