Property Summary

NCBI Gene PubMed Count 141
PubMed Score 952.55
PubTator Score 458.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (8)

Gene RIF (90)

AA Sequence

MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGV      1 - 70
KYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQ     71 - 140
QKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPL    141 - 210
PAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQV    211 - 280
GEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQE    281 - 350
LLEEVKKELQKVKEEIIEAFVQELRKRGSP                                            351 - 380
//

Text Mined References (157)

PMID Year Title