Property Summary

NCBI Gene PubMed Count 79
PubMed Score 127.07
PubTator Score 86.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma 1.900 5.3e-03
Astrocytoma, Pilocytic 1.300 1.5e-02
Breast cancer -2.600 1.5e-16
breast carcinoma -1.200 4.5e-13
cystic fibrosis 1.101 1.4e-04
ependymoma -1.200 4.8e-05
glioblastoma 1.300 5.0e-03
lung adenocarcinoma -1.500 5.3e-14
lung cancer -1.200 2.2e-02
malignant mesothelioma -1.900 4.7e-06
medulloblastoma, large-cell -3.400 6.1e-04
non-small cell lung cancer -1.623 8.4e-14
oligodendroglioma 2.400 7.4e-03
osteosarcoma 1.326 8.0e-03
ovarian cancer 1.100 7.0e-08
pancreatic cancer 1.300 4.7e-04
pediatric high grade glioma 1.400 1.6e-02
pituitary cancer -2.700 7.5e-07
psoriasis -1.500 9.1e-03
severe Alzheimer's disease -1.504 1.7e-02
sonic hedgehog group medulloblastoma -1.600 2.5e-02
subependymal giant cell astrocytoma -2.900 1.3e-03

Protein-protein Interaction (3)

Gene RIF (52)

AA Sequence

MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQF      1 - 70
VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTP     71 - 140
SSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPM    141 - 210
YQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQE    211 - 280
GFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN    281 - 350
SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA    351 - 420
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY                 421 - 477
//

Text Mined References (81)

PMID Year Title