Property Summary

NCBI Gene PubMed Count 73
Grant Count 83
R01 Count 52
Funding $6,725,847.16
PubMed Score 120.04
PubTator Score 86.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
astrocytic glioma 2.400 0.014
oligodendroglioma 3.000 0.005
psoriasis -1.500 0.009
glioblastoma 1.800 0.018
osteosarcoma 1.326 0.008
posterior fossa group B ependymoma -2.400 0.000
cystic fibrosis 3.232 0.000
medulloblastoma, large-cell -3.400 0.001
non-small cell lung cancer -1.623 0.000
lung cancer -3.000 0.000
pancreatic cancer 1.300 0.000
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma 1.800 0.002
pilocytic astrocytoma 1.300 0.015
sonic hedgehog group medulloblastoma -1.600 0.025
subependymal giant cell astrocytoma -3.252 0.027
severe Alzheimer's disease -1.504 0.017
breast carcinoma -1.200 0.000
Breast cancer -2.600 0.000
ovarian cancer 3.200 0.000
pituitary cancer -2.700 0.000

Gene

PANTHER Protein Class (1)

PDB

4AVP   4BNC  

Gene RIF (47)

PMID Text
26731476 these data reveal a JMJD2A/ETV1/YAP1 axis that promotes prostate cancer initiation and that may be a suitable target for therapeutic inhibition.
26243012 conclude that ETV1 is specifically expressed in the majority of gastrointestinal stromal tumors, even in some KIT-negative cases
25884720 ETV1 and COP1 are a pair of independent predictors of prognosis for triple-negative breast cancer.
25736805 mutation of the KIT protein that stabilizes ETV1 is likely to be a key step by which an endogenous brain-cell progenitor may form a germinoma.
25631336 These results illuminate the complex interplay of AR, ETV1, and PTEN pathways in pre-cancerous neoplasia and early tumorigenesis
25595908 ETV1 overexpression is associated with prostate cancer aggressiveness.
25479232 YK-4-279 is a potent inhibitor of ETV1 and inhibits both the primary tumor growth and metastasis of fusion positive prostate cancer xenografts.
25203299 developed a novel RNA in situ hybridization-based assay for the in situ detection of ETV1, ETV4, and ETV5 in formalin-fixed paraffin-embedded tissues from prostate needle biopsies, prostatectomy, and metastatic PCa specimens using RNA probes
25073704 ETV1 expression is a rare event in human melanoma and seems to be rather based on hyperactivation of MAPK signals, by BRAF (V600E) mutation, than on ETV1 gene amplification.
24970355 Results show that ETV1 was upregulated at a higher rate in Gastrointestinal stromal tumor and was correlated with KIT expression.
More...

AA Sequence

MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQF      1 - 70
VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTP     71 - 140
SSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPM    141 - 210
YQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQE    211 - 280
GFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN    281 - 350
SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA    351 - 420
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY                 421 - 477
//

Text Mined References (74)

PMID Year Title
26731476 2016 Histone demethylase JMJD2A drives prostate tumorigenesis through transcription factor ETV1.
26243012 2015 ETV1 mRNA is specifically expressed in gastrointestinal stromal tumors.
25884720 2015 COP1, the negative regulator of ETV1, influences prognosis in triple-negative breast cancer.
25736805 2015 Expression of Kit and Etv1 in restricted brain regions supports a brain-cell progenitor as an origin for cranial germinomas.
25631336 2015 Interaction of the Androgen Receptor, ETV1, and PTEN Pathways in Mouse Prostate Varies with Pathological Stage and Predicts Cancer Progression.
25595908 2015 Specific and redundant activities of ETV1 and ETV4 in prostate cancer aggressiveness revealed by co-overexpression cellular contexts.
25479232 2014 A small molecule inhibitor of ETV1, YK-4-279, prevents prostate cancer growth and metastasis in a mouse xenograft model.
25203299 2014 Novel RNA hybridization method for the in situ detection of ETV1, ETV4, and ETV5 gene fusions in prostate cancer.
25073704 2014 MAP kinase activity supported by BRAF (V600E) mutation rather than gene amplification is associated with ETV1 expression in melanoma brain metastases.
24970355 2014 Altered expression of ETV1 and its contribution to tumorigenic phenotypes in gastrointestinal stromal tumors.
More...