Property Summary

NCBI Gene PubMed Count 82
Grant Count 48
R01 Count 27
Funding $8,323,538.36
PubMed Score 269.57
PubTator Score 128.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.003

Gene RIF (33)

PMID Text
26547791 Our data suggest that the functional polymorphism rs3814058C>T in 3'-UTR of PXR may be a functional biomarker to predict risk of colorectal cancer
26344566 Data show that ataxia-telangiectasia mutated (ATM) phosphorylates peroxisomal biogenesis factor 5 (PEX5) at serine 141 in response to reactive oxygen species.
26220973 PEX5 encodes two isoforms, PEX5L & PEX5S, & a homozygous frame shift mutation c.722dupA (p.Val242Glyfs( *)33), located in the PEX5L-specific exon 9, results in loss of PEX5L only. Loss of PEX5L results in deficient import of PTS2-tagged proteins
26138649 our data suggest that insertion of the trimeric PEX5-PEX7-PTS2 protein complex into the DTM is probably accompanied by conformational alterations in PEX5 to allow release of the PTS2 protein into the organelle matrix
25689234 the molecular recognition of PTS1 cargo proteins by Pex5p
25369882 bulky side chain within the recognition motif, which blocks contraction of the PEX5 binding cavity
24662292 ubiquitination of peroxisome-targeting signal type 1 (PTS1) receptor Pex5p regulating PTS1 protein import
24453954 PEX5 has a role in regulating peroxisome numbers by signaling to mediate pexophagy
24235149 The novel Pex14-binding site may represent the initial tethering site of Pex5 from which the cargo-loaded receptor is further processed in a sequential manner.
24118911 Cys11 in PEX5 serves as a functional redox switch regulating the peroxisomal/cytosolic localization of peroxisomal proteins.
More...

AA Sequence

MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAASKPLGVASEDELVAEFLQDQ      1 - 70
NAPLVSRAPQTFKMDDLLAEMQQIEQSNFRQAPQRAPGVADLALSENWAQEFLAAGDAVDVTQDYNETDW     71 - 140
SQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKL    141 - 210
ANSEFLKFVRQIGEGQVSLESGAGSGRAQAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSA    211 - 280
IESDVDFWDKLQAELEEMAKRDAEAHPWLSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGD    281 - 350
LPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQR    351 - 420
QACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDV    421 - 490
QCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRY    491 - 560
NLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLST    561 - 630
LLTMFGLPQ                                                                 631 - 639
//

Text Mined References (85)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26547791 2015 Functional variants inPXRare associated with colorectal cancer susceptibility in Chinese populations.
26344566 2015 ATM functions at the peroxisome to induce pexophagy in response to ROS.
26220973 2015 A novel type of rhizomelic chondrodysplasia punctata, RCDP5, is caused by loss of the PEX5 long isoform.
26138649 2015 Revisiting the intraperoxisomal pathway of mammalian PEX7.
25689234 2015 Molecular recognition of PTS-1 cargo proteins by Pex5p: implications for protein mistargeting in primary hyperoxaluria.
25416956 2014 A proteome-scale map of the human interactome network.
25369882 2015 Ligand-induced compaction of the PEX5 receptor-binding cavity impacts protein import efficiency into peroxisomes.
24662292 2014 Distinct modes of ubiquitination of peroxisome-targeting signal type 1 (PTS1) receptor Pex5p regulate PTS1 protein import.
24453954 2014 PEX5 and ubiquitin dynamics on mammalian peroxisome membranes.
More...