Property Summary

NCBI Gene PubMed Count 43
Grant Count 226
R01 Count 173
Funding $19,219,651.85
PubMed Score 103.49
PubTator Score 73.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.174 0.012
Multiple myeloma 1.768 0.002
glioblastoma -1.400 0.007
ulcerative colitis -1.600 0.000
colon cancer -1.500 0.041
adult high grade glioma -1.100 0.000
spina bifida -1.022 0.045
Breast cancer -1.700 0.000
ovarian cancer -2.100 0.000

Synonym

Accession P50539 B1ANN7 D3DR25 D3DRA9 Q15887 Q6FHW2 Q96E53 Max interactor 1
Symbols MXI
MAD2
MXD2
bHLHc11

Gene

Gene RIF (18)

PMID Text
24685915 MYC-HEG and MXI1-LEG levels are associated with poor prognosis in patients with breast cancer, suggesting that they may be useful molecular markers in breast cancer prognosis prediction.
24403858 MXI1-0 appears to be a downstream target of MYCN-dependent signaling pathways and may contribute to N-Myc-dependent cell growth and proliferation.
24376632 MicroRNA-155 promotes glioma cell proliferation via the regulation of MXI1.
23254855 These findings reveal, for the first time, the novel functions of cooperation of miR243p and miR27a3p from two clusters in promoting cell proliferation through MXI1.
19254710 MAX interactor-1 (MXI1) gene is directly regulated by HIF-1alpha protein in neuroblastoma and breast cancer cells.
19018165 Mxi1 is an important downstream target of HIF that contributes to pVHL-deficient renal cancer tumorigenesis
18457265 Missense mutations in Mad1, Mxi1 and Rox were found in acute leukemia patients.
17697116 Mxi1 gains functional complexity by encoding isoforms with shared and distinct activities
17577784 Mad1, Mxi1 and Rox genes were expressed and displayed mutations in haematological malignancies.
17452451 These results provide evidence of direct regulation of Mxi1 by FOXO3a and imply an additional mechanism through which the PI3-kinase/Akt/FOXO pathway can modulate Myc function.
More...

AA Sequence

MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRS      1 - 70
THNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFL     71 - 140
KWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPS    141 - 210
IGSDEGYSSASVKLSFTS                                                        211 - 228
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
24685915 2014 MYC and MXI1 protein expression: potential prognostic significance in women with breast cancer in China.
24403858 2013 N-Myc differentially regulates expression of MXI1 isoforms in neuroblastoma.
24376632 2013 MicroRNA-155 promotes glioma cell proliferation via the regulation of MXI1.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23254855 2013 miR-24-3p and miR-27a-3p promote cell proliferation in glioma cells via cooperative regulation of MXI1.
19254710 2009 HIF-1alpha induces MXI1 by alternate promoter usage in human neuroblastoma cells.
19018165 2008 Inhibition of Mxi1 suppresses HIF-2alpha-dependent renal cancer tumorigenesis.
More...