Property Summary

NCBI Gene PubMed Count 47
PubMed Score 107.70
PubTator Score 73.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Kidney Diseases 110 0.0 0.0
Prostatic Neoplasms 472 0.0 0.0
Disease Target Count
Malignant neoplasm of prostate 11
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Multiple Sclerosis 527 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 164 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2388 3.334 1.7
Disease Target Count
Malignant tumor of prostate 26

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 4.3e-04
Breast cancer -1.700 1.1e-13
Chronic Lymphocytic Leukemia 1.174 1.2e-02
colon cancer -1.500 4.1e-02
glioblastoma -1.400 6.6e-03
Multiple myeloma 1.768 1.9e-03
ovarian cancer -2.100 9.1e-08
spina bifida -1.022 4.5e-02
ulcerative colitis -1.275 4.6e-02

Gene RIF (20)

AA Sequence

MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRS      1 - 70
THNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFL     71 - 140
KWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPS    141 - 210
IGSDEGYSSASVKLSFTS                                                        211 - 228
//

Text Mined References (48)

PMID Year Title