Property Summary

NCBI Gene PubMed Count 42
PubMed Score 82.31
PubTator Score 646.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Down syndrome 1.200 2.8e-03
invasive ductal carcinoma -1.038 9.5e-04
Multiple myeloma 1.296 3.6e-03
oligodendroglioma 1.100 3.5e-02
ovarian cancer -2.200 1.6e-07
pancreatic ductal adenocarcinoma liver m... -1.597 1.6e-02
Waldenstrons macroglobulinemia 1.513 7.6e-03

Gene RIF (14)

AA Sequence

MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK      1 - 70
ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA     71 - 140
IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK    141 - 210
LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS    211 - 280
FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS    281 - 350
NPKVMNLISKLSAKFGGQA                                                       351 - 369
//

Text Mined References (44)

PMID Year Title