Property Summary

NCBI Gene PubMed Count 42
PubMed Score 75.62
PubTator Score 646.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.513 0.008
Multiple myeloma 1.296 0.004
oligodendroglioma 1.100 0.035
pancreatic ductal adenocarcinoma liver m... -1.597 0.016
invasive ductal carcinoma -1.038 0.001
ovarian cancer -2.600 0.000
Down syndrome 1.200 0.003

Synonym

Accession P50502 O14999 Q2TU77 Hip
Symbols HIP
HOP
P48
AAG2
SNC6
HSPABP
FAM10A1
FAM10A4
HSPABP1
PRO0786

Gene

PDB

1UZS  

Gene RIF (14)

PMID Text
25616159 A novel susceptibility gene, ST13, coding for a cochaperone of the glucocorticoid receptor, is associated with exacerbations in asthmatic children and young adults despite their ICS use.
23125081 St13 is a proliferation regulator that inhibits tumor growth in colorectal neoplasms and may affect cell migration.
21767636 Akt phosphorylation at Thr308 and Ser473 is required for CHIP-mediated ubiquitination of the kinase.
21728385 Hip has been identified as a novel substrate of GRK5 in vitro and in cells, and phosphorylation of Hip by GRK5 plays a role in modulating CXCR4 internalization
21240662 A single amino acid substitution (L211S) resulted in a loss of Hip function. This mutation also appears to disrupt the interaction of Hip with Hsp70 in vitro
20534503 S-nitrosoglutathione corrects DeltaF508 CFTR trafficking by inhibiting Hop expression
20512919 These results strongly indicate ST13 mediated by adenovirus triggers colorectal cell apoptosis via ASK1-JNK signaling cascade
20193743 The expression levels of ST13 cannot serve as a biomarker for early stages of PD.
17535810 analysis of similarity between the chloroplast translocon component, Tic40, and the human co-chaperone, Hsp70-interacting protein
17013759 results suggest that granzyme B-mediated loss of HIP expression occurs in vivo, and in a coordinate fashion with loss of BID, pro-caspase-8 and pro-caspase-3; data implicate the Hsp70 co-chaperone HIP in the proteolytic cascade of some apoptotic pathways
More...

AA Sequence

MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK      1 - 70
ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA     71 - 140
IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK    141 - 210
LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS    211 - 280
FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS    281 - 350
NPKVMNLISKLSAKFGGQA                                                       351 - 369
//

Text Mined References (44)

PMID Year Title
25616159 2015 ST13 polymorphisms and their effect on exacerbations in steroid-treated asthmatic children and young adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23125081 2012 ST13, a proliferation regulator, inhibits growth and migration of colorectal cancer cell lines.
21767636 2011 Akt phosphorylation at Thr308 and Ser473 is required for CHIP-mediated ubiquitination of the kinase.
21728385 2011 G protein-coupled receptor kinase 5 phosphorylation of hip regulates internalization of the chemokine receptor CXCR4.
21240662 2011 Single-point mutation in a conserved TPR domain of Hip disrupts enhancement of glucocorticoid receptor signaling.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20534503 2010 Hsp 70/Hsp 90 organizing protein as a nitrosylation target in cystic fibrosis therapy.
20512919 2010 ASK1-JNK signaling cascade mediates Ad-ST13-induced apoptosis in colorectal HCT116 cells.
More...