Property Summary

NCBI Gene PubMed Count 28
PubMed Score 99.10
PubTator Score 24.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -1.200 4.3e-02
Astrocytoma, Pilocytic 1.300 4.3e-03
Breast cancer -2.300 4.3e-20
breast carcinoma -1.300 2.2e-13
ependymoma 1.400 1.9e-02
esophageal adenocarcinoma -1.600 4.3e-02
gastric carcinoma 2.000 3.0e-02
glioblastoma 1.500 2.8e-02
interstitial lung disease 1.600 1.4e-02
intraductal papillary-mucinous adenoma (... -1.200 6.4e-03
intraductal papillary-mucinous carcinoma... -1.700 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.200 3.6e-02
lung cancer 2.800 1.1e-03
non-small cell lung cancer 1.827 8.8e-14
osteosarcoma 1.903 3.1e-03
ovarian cancer -1.100 1.7e-03
pancreatic cancer 1.800 4.1e-03
pituitary cancer -3.200 8.1e-12
primary pancreatic ductal adenocarcinoma 2.081 4.5e-03
psoriasis -2.100 1.4e-10
sonic hedgehog group medulloblastoma -1.400 7.3e-03
subependymal giant cell astrocytoma 2.502 2.6e-03
ulcerative colitis 1.200 1.0e-03

Gene RIF (13)

AA Sequence

MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIK      1 - 70
GCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPSGTGTGPEDGRPSLGSPYGQP     71 - 140
PRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSRDCRVDLGSEVYRMLREPAEPVAAEPKQSGS    141 - 210
FRYLQGMLEAGEGGDWPGPGGPRNLKPTASKLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFM    211 - 280
CSDCGLNLKQRGYFFLDERLYCESHAKARVKPPEGYDVVAVYPNAKVELV                        281 - 330
//

Text Mined References (34)

PMID Year Title