Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
Funding $2,427,868.75
PubMed Score 96.26
PubTator Score 24.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
24039914 The levels of the EDNRB, HJURP and p60/CAF-1 proteins were strongly associated with overall survival in high-grade gliomas patients (p<0.001, p<0.001 and p=0.002, respectively), whereas the one of PDLI4 was not (P=0.11).
22695491 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancers was associated with clinical characteristics, but only RASSF1A methylation was associated with time to first recurrence and overall survival.
21636573 Actin cytoskeleton remodeling by the alternatively spliced isoform of PDLIM4/RIL protein.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19307596 Reversion-induced LIM interaction with Src reveals a novel Src inactivation cycle.
19212833 PDLIM4 may function as a tumor suppressor, involved in the control of cell proliferation by associating with actin in prostate cancer cells.
19131452 Observational study of gene-disease association. (HuGE Navigator)
19011242 several genes that are known to be regulated by DNA methylation were up-regulated dramatically by integrin alpha6beta4 expression, including S100A4, FST, PDLIM4, CAPG, and Nkx2.2.
17332327 RIL methylation is a marker of adverse prognosis independent of chromosome 5 and 7 deletions.
16489065 Results showed that the hypermethylation of PDLIM4 gene could be used as a sensitive molecular tool in detection of prostate.
More...

AA Sequence

MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIK      1 - 70
GCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPSGTGTGPEDGRPSLGSPYGQP     71 - 140
PRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSRDCRVDLGSEVYRMLREPAEPVAAEPKQSGS    141 - 210
FRYLQGMLEAGEGGDWPGPGGPRNLKPTASKLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFM    211 - 280
CSDCGLNLKQRGYFFLDERLYCESHAKARVKPPEGYDVVAVYPNAKVELV                        281 - 330
//

Text Mined References (32)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24039914 2013 Prognostic significance of EDN/RB, HJURP, p60/CAF-1 and PDLI4, four new markers in high-grade gliomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22695491 2012 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21636573 2011 Actin cytoskeleton remodeling by the alternatively spliced isoform of PDLIM4/RIL protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...