Property Summary

NCBI Gene PubMed Count 38
PubMed Score 105.22
PubTator Score 286.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

AA Sequence

MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG      1 - 70
IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW     71 - 140
HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE                    141 - 194
//

Text Mined References (37)

PMID Year Title