Property Summary

NCBI Gene PubMed Count 38
Grant Count 106
R01 Count 42
Funding $18,625,960.35
PubMed Score 93.76
PubTator Score 286.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P50461 Q9P131 S4S7M7
Symbols CLP
MLP
CRP3
LMO4
CMD1M
CMH12

Gene

PDB

2O10   2O13  

Gene RIF (23)

PMID Text
24934443 MLP contributes to the maintenance of cardiomyocyte cytoarchitecture by a mechanism involving its self-association and actin filament cross-linking.
24860983 study reports the discovery of an alternative splice variant of muscle lim protein encoded by the CSRP3 gene, designated as MLP-b, showing distinct expression in neuromuscular disease and direct roles in actin dynamics and muscle differentiation
22584587 KLF5 reverses hhLIM function from anti-proliferation to pro-proliferation through its interaction with hhLIM on the cyclin E promoter.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20474083 Observational study of genetic testing. (HuGE Navigator)
20201937 Observational study of gene-disease association. (HuGE Navigator)
20044516 The CSRP3-W4R mutation causes cardiomyopathy and heart failure in patients and engineered knock-in animals.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875404 Observational study of gene-disease association. (HuGE Navigator)
19752190 MLP binds directly to CFL2 in human cardiac and skeletal muscles.
More...

AA Sequence

MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG      1 - 70
IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW     71 - 140
HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE                    141 - 194
//

Text Mined References (37)

PMID Year Title
27353086 2016 MLP and CARP are linked to chronic PKC? signalling in dilated cardiomyopathy.
24934443 2014 Human muscle LIM protein dimerizes along the actin cytoskeleton and cross-links actin filaments.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
22584587 2012 KLF5 and hhLIM cooperatively promote proliferation of vascular smooth muscle cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20201937 2010 Common susceptibility variants examined for association with dilated cardiomyopathy.
20044516 2010 A common MLP (muscle LIM protein) variant is associated with cardiomyopathy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875404 2009 The role of Lamin A/C mutations in Danish patients with idiopathic dilated cardiomyopathy.
More...