Property Summary

NCBI Gene PubMed Count 19
Grant Count 89
R01 Count 63
Funding $9,178,999.55
PubMed Score 87.70
PubTator Score 114.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 5.300 0.000
astrocytic glioma -2.700 0.010
posterior fossa group B ependymoma -4.200 0.000
psoriasis -1.500 0.001
osteosarcoma 1.010 0.042
glioblastoma -1.800 0.005
nasopharyngeal carcinoma 2.700 0.000
ovarian cancer -5.500 0.000

Synonym

Accession P50458 O95860 Q52M57 Q8N1Z3 Homeobox protein LH-2
Symbols LH2
hLhx2

Gene

Gene RIF (9)

PMID Text
26189214 Findings demonstrate that miR-1238 inhibit the proliferation of NSCLC cells at least partly via repression of LHX2, shedding light on the mechanistic interaction of miR-1238 and LHX2 in NSCLC carcinogenesis.
25505333 Lhx2 directly regulates tanycyte specification and differentiation in the hypothalamus.
25324171 Results show that LHX2 is overexpressed in pancreatic ductal adenocarcinoma cells and is involved in promoting cancer cell proliferation and enhanced tumor development.
24423492 The data indicate a dual role of Lhx2 during EMT and tumor progression: by inducing the expression of PDGF-B, Lhx2 provokes an autocrine PDGF-B/PDGFRbeta loop required for cell migration, invasion and metastatic dissemination
23804753 The findings indicate that LHX2 regulates the transcription of downstream intrinsic and extrinsic molecules that are essential for early neural differentiation.
23307637 This study demonistrated that LHx2 regulates the development of the forebrain hem system.
22535646 These results suggest that if LHX2 is involved in pituitary hormone deficiency associated with posterior pituitary and ocular defects, it would be a rare cause of this disease condition.
21203406 Mutations in LHX2 do not represent a frequent cause of micro/anophthalmia.
20949537 A large cohort of patients with schizencephaly, some with features of septo-optic dysplasia, were sequenced for mutations in LHX2, HESX1 and SOX2.

AA Sequence

MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVD      1 - 70
KQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNC     71 - 140
FTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGANPLG    141 - 210
LPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRT    211 - 280
MKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGPA    281 - 350
SELSNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF                  351 - 406
//

Text Mined References (19)

PMID Year Title
26189214 2015 miR-1238 inhibits cell proliferation by targeting LHX2 in non-small cell lung cancer.
25505333 2014 The LIM homeodomain factor Lhx2 is required for hypothalamic tanycyte specification and differentiation.
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
25324171 2014 Oncogenicity of LHX2 in pancreatic ductal adenocarcinoma.
24423492 2014 LIM-homeobox gene 2 promotes tumor growth and metastasis by inducing autocrine and paracrine PDGF-B signaling.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23804753 2013 LHX2 regulates the neural differentiation of human embryonic stem cells via transcriptional modulation of PAX6 and CER1.
23307637 2014 Lhx2 regulates the development of the forebrain hem system.
22535646 2012 Screening of LHX2 in patients presenting growth retardation with posterior pituitary and ocular abnormalities.
21203406 2010 Mutations in the LHX2 gene are not a frequent cause of micro/anophthalmia.
More...