Property Summary

NCBI Gene PubMed Count 82
PubMed Score 1526.90
PubTator Score 290.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 31 4.913 2.5

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.200 3.0e-03
astrocytoma 1.100 4.6e-02
Astrocytoma, Pilocytic 1.200 3.9e-03
atypical teratoid / rhabdoid tumor 3.200 5.6e-08
Becker muscular dystrophy 1.071 2.7e-05
Breast cancer 1.100 3.7e-05
ependymoma 1.300 4.2e-02
esophageal adenocarcinoma 1.400 1.9e-02
gastric carcinoma 1.700 2.4e-02
glioblastoma 1.700 4.8e-06
intraductal papillary-mucinous adenoma (... -1.200 4.4e-03
lung adenocarcinoma 1.476 3.9e-09
medulloblastoma, large-cell 1.300 1.4e-02
non-small cell lung cancer 1.107 8.0e-11
osteosarcoma 3.676 3.5e-06
ovarian cancer 2.800 4.1e-05
pancreatic cancer 1.200 6.9e-04
pituitary cancer -1.200 1.0e-02
primary pancreatic ductal adenocarcinoma 2.772 1.4e-04
primitive neuroectodermal tumor 1.800 7.2e-04
psoriasis 2.300 1.0e-03
sonic hedgehog group medulloblastoma 1.400 4.6e-04
subependymal giant cell astrocytoma 1.789 1.2e-02

Gene RIF (56)

AA Sequence

MRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVS      1 - 70
PVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSV     71 - 140
SFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHW    141 - 210
DEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLER    211 - 280
LEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLAS    281 - 350
VFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL      351 - 418
//

Text Mined References (87)

PMID Year Title