Property Summary

NCBI Gene PubMed Count 75
Grant Count 196
R01 Count 119
Funding $30,913,435.06
PubMed Score 1424.11
PubTator Score 290.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Disease Z-score Confidence
Chorioamnionitis 15 7.433 3.7
Oligohydramnios 18 5.842 2.9
Funisitis 8 5.608 2.8
Placental abruption 15 5.517 2.8
Periventricular leukomalacia 6 4.989 2.5
Tropical spastic paraparesis 17 4.85 2.4
Osteogenesis imperfecta 34 4.752 2.4
Perinatal necrotizing enterocolitis 18 4.559 2.3
Cervical incompetence 7 4.456 2.2
Spinal cord disease 22 4.373 2.2
Endometritis 21 3.917 2.0
Endocarditis 18 3.912 2.0
twin-to-twin transfusion syndrome 11 3.854 1.9
Bacterial vaginosis 15 3.609 1.8
Hypertension 287 3.492 1.7
Cerebral palsy 28 3.455 1.7
Placenta praevia 9 3.296 1.6
Retinopathy of prematurity 21 3.272 1.6
Pneumonia 133 3.199 1.6
Dental caries 67 3.187 1.6
Pulmonary Fibrosis 66 3.185 1.6
Becker muscular dystrophy 187
Breast cancer 3,094
Infarction, Middle Cerebral Artery 25
Ischemia 27
Liver Cirrhosis 101
Liver Cirrhosis, Experimental 108
OSTEOGENESIS IMPERFECTA, TYPE X 1
Osteogenesis imperfecta type III (disord... 11 
Preterm premature rupture of membranes (... 3 
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
lung adenocarcinoma 2,713
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287

Expression

Synonym

Accession P50454 B3KVJ3 P29043 Q5XPB4 Q6NSJ6 Q8IY96 Q9NP88
Symbols CBP1
CBP2
OI10
gp46
AsTP3
HSP47
PIG14
PPROM
RA-A47
SERPINH2

Gene

 GWAS Trait (1)

Gene RIF (52)

PMID Text
26692483 Although the chemical chaperone 4-PBA partially restores the solubility of the Hsp47 OI mutants, collagen-binding activity of Hsp47 was not improved.
26091621 Data show that the expression of heat shock protein 47 (HSP47) was increased in the peripheral blood mononuclear cells and plasma from scleroderma patients.
25758142 The present study demonstrates that HSP47 promotes glioma angiogenesis and highlights the importance of HSP47 as an attractive therapeutic target of GBM.
25744716 Hsp47 expression promotes cancer progression in part by enhancing deposition of extracellular matrix proteins.
25510505 Mutations in the HSP47 and FKBP65 produce a moderately severe form of Osteogenesis imperfect.
25111595 In patients with schistosomiasis japonica, TGF-beta1 participates not only in the inflammatory process, but also in the fibrotic process in which Hsp47 and CTGF probably play a key role.
24650661 miR-29b down-regulates HSP47 and LOX expression.
24623841 HSP47 is a novel glioma-associated antigen
24534724 IL-17A-induced HSP47 expression is involved in collagen I expression in intestinal subepithelial myofibroblasts, which might contribute to intestinal fibrosis in Crohn's disease.
24141696 silencing of the HSP47 gene significantly inhibited cell migration and invasion in cancer cells and the expression of HSP47 was upregulated in cancer tissues and cervical intraepithelial neoplasia, as demonstrated by immunostaining.
More...

AA Sequence

MRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVS      1 - 70
PVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSV     71 - 140
SFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHW    141 - 210
DEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLER    211 - 280
LEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLAS    281 - 350
VFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL      351 - 418
//

Text Mined References (80)

PMID Year Title
26692483 2016 Mutants of collagen-specific molecular chaperone Hsp47 causing osteogenesis imperfecta are structurally unstable with weak binding affinity to collagen.
26091621 2015 Involvement of collagen-binding heat shock protein 47 in scleroderma-associated fibrosis.
25758142 2016 Heat Shock Protein 47 Promotes Glioma Angiogenesis.
25744716 2015 Chaperone Hsp47 Drives Malignant Growth and Invasion by Modulating an ECM Gene Network.
25510505 2015 HSP47 and FKBP65 cooperate in the synthesis of type I procollagen.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25111595 2015 Expression of heat shock protein 47, transforming growth factor-beta 1, and connective tissue growth factor in liver tissue of patients with Schistosoma japonicum-induced hepatic fibrosis.
24650661 2014 MiR-29b inhibits collagen maturation in hepatic stellate cells through down-regulating the expression of HSP47 and lysyl oxidase.
24623841 2014 CTL responses to HSP47 associated with the prolonged survival of patients with glioblastomas.
More...