Property Summary

NCBI Gene PubMed Count 53
PubMed Score 293.23
PubTator Score 112.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -2.297 7.7e-04
Atopic dermatitis 1.500 6.9e-04
cutaneous lupus erythematosus 2.000 1.1e-03
gastric carcinoma 1.700 3.1e-02
group 3 medulloblastoma -1.600 4.4e-04
head and neck cancer and chronic obstruc... 1.100 1.7e-02
interstitial cystitis 2.200 1.1e-02
intraductal papillary-mucinous adenoma (... -2.100 1.4e-03
intraductal papillary-mucinous carcinoma... -1.600 7.4e-03
juvenile dermatomyositis 1.214 1.8e-09
lung adenocarcinoma -1.123 9.3e-04
lung cancer -1.300 9.7e-03
lung carcinoma -2.100 3.8e-18
malignant mesothelioma -2.700 1.1e-05
medulloblastoma, large-cell -2.300 7.3e-06
non-small cell lung cancer -1.224 3.9e-08
oligodendroglioma -2.200 1.1e-02
ovarian cancer -3.100 4.0e-09
primary pancreatic ductal adenocarcinoma 1.088 1.5e-02
primary Sjogren syndrome 2.000 1.6e-04
psoriasis 1.200 4.3e-05
tuberculosis -2.100 1.3e-06
ulcerative colitis 3.000 1.8e-06

Gene RIF (29)

AA Sequence

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF      1 - 70
QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT     71 - 140
EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG    141 - 210
EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM    211 - 280
ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC    281 - 350
ADHPFLFFIRHNRANSILFCGRFSSP                                                351 - 376
//

Text Mined References (59)

PMID Year Title