Property Summary

NCBI Gene PubMed Count 50
Grant Count 25
R01 Count 16
Funding $1,684,984.96
PubMed Score 283.26
PubTator Score 112.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
26993499 Data show that oropharyngeal squamous cell carcinomas (OPSCCs) express granzyme inhibitors SERPINB1, SERPINB4 and SERPINB9 for cytotoxicity and the expression was not different between human papillomavirus (HPV)-positive and HPV-negative tumors.
26963506 Pediatric CNS-PNETs evade immune recognition by downregulating cell surface MHC-I and CD1d expression. Intriguingly, expression of SERPINB9, SERPINB1, and SERPINB4 is acquired during tumorigenesis in 29%, 29%, and 57% of the tumors
26670609 Data suggest that reactive oxygen species (ROS) generated within cytotoxic lymphocytes by receptor stimulation are required for lysosomal permeabilization and release of GzmB (granzyme B) into the cytosol and for inactivation of serpin B9.
24488096 The GrB-Sb9 nexus may therefore represent an additional mechanism of limiting lymphocyte lifespan and populations.
24445365 Increased intracellular PI-9 activity in mononuclear phagocytes from HIV-infected patients contributes to successful intracellular infection by virulent Mycobacterium tuberculosis.
23892923 Suppression of granzyme B initiated apoptosis in protease inhibitor-9-expressing leukemia cells.
22387007 lung cancer cells utilise their increased PI-9 expression to protect from granzyme B-mediated cytotoxicity as an immune evasion mechanism
22167597 SerpinB9 expression in human renal tubular epithelial cells is induced by triggering of the viral dsRNA sensors TLR3, MDA5 and RIG-I during subclinical rejection.
22090449 PI-9 induction within human mononuclear phagocytes by virulent Mycobacterium tuberculosis serves to protect these primary targets of infection from elimination by apoptosis and thereby promotes intracellular survival of the organism.
21919028 Inhibition of Granzyme B by PI-9 protects prostate cancer cells from apoptosis.
More...

AA Sequence

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF      1 - 70
QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT     71 - 140
EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG    141 - 210
EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM    211 - 280
ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC    281 - 350
ADHPFLFFIRHNRANSILFCGRFSSP                                                351 - 376
//

Text Mined References (56)

PMID Year Title
26993499 2016 Oropharyngeal squamous cell carcinomas differentially express granzyme inhibitors.
26963506 2016 Pediatric Primitive Neuroectodermal Tumors of the Central Nervous System Differentially Express Granzyme Inhibitors.
26670609 2016 A Novel Serpin Regulatory Mechanism: SerpinB9 IS REVERSIBLY INHIBITED BY VICINAL DISULFIDE BOND FORMATION IN THE REACTIVE CENTER LOOP.
25416956 2014 A proteome-scale map of the human interactome network.
24488096 2014 The granzyme B-Serpinb9 axis controls the fate of lymphocytes after lysosomal stress.
24445365 2014 Role of protease inhibitor 9 in survival and replication of Mycobacterium tuberculosis in mononuclear phagocytes from HIV-1-infected patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23892923 2013 Suppression of granzyme B activity and caspase-3 activation in leukaemia cells constitutively expressing the protease inhibitor 9.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...