Property Summary

NCBI Gene PubMed Count 21
PubMed Score 221.53
PubTator Score 18.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.400 1.0e-07
active ulcerative colitis 1.171 3.8e-02
adult high grade glioma 1.200 4.8e-03
atypical teratoid / rhabdoid tumor 1.200 7.3e-03
cystic fibrosis 1.391 7.3e-06
glioblastoma 1.200 2.7e-04
lung cancer -1.300 1.0e-02
lung carcinoma -1.800 8.5e-22
malignant mesothelioma -1.800 2.3e-07
medulloblastoma, large-cell 1.600 2.3e-05
non diabetic and post-ischemic heart fai... -1.100 7.4e-03
osteosarcoma 2.168 3.4e-07
ovarian cancer 2.300 2.0e-12
Pilocytic astrocytoma 1.100 4.4e-07
tuberculosis -1.900 8.8e-07

Gene RIF (7)

AA Sequence

MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF      1 - 70
QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT     71 - 140
EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE    141 - 210
VHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLE    211 - 280
PFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCAD    281 - 350
HPFLFFIRHHKTNCILFCGRFSSP                                                  351 - 374
//

Text Mined References (26)

PMID Year Title