Property Summary

NCBI Gene PubMed Count 21
PubMed Score 220.75
PubTator Score 18.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.400 0.000
malignant mesothelioma -1.800 0.000
osteosarcoma 2.168 0.000
cystic fibrosis 1.391 0.000
non diabetic and post-ischemic heart fai... -1.100 0.007
atypical teratoid / rhabdoid tumor 1.200 0.007
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
tuberculosis and treatment for 3 months -2.000 0.000
lung cancer -1.500 0.001
ulcerative colitis 1.400 0.001
adult high grade glioma 1.200 0.005
pilocytic astrocytoma 1.100 0.000
lung carcinoma -1.800 0.000
ovarian cancer 2.300 0.000

Gene RIF (6)

PMID Text
20953187 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19188865 Data show that SERPINB8 is expressed in normal neuroendocrine cells of several organs as well as in neuroendocrine tumors of the pancreas, where it can be used as an additional diagnostic immunohistochemical marker.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16493485 PI8 is released by platelets and controls functional responses

AA Sequence

MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGF      1 - 70
QSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKT     71 - 140
EGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADE    141 - 210
VHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLE    211 - 280
PFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCAD    281 - 350
HPFLFFIRHHKTNCILFCGRFSSP                                                  351 - 374
//

Text Mined References (26)

PMID Year Title
27476651 2016 Loss-of-Function Mutations in SERPINB8 Linked to Exfoliative Ichthyosis with Impaired Mechanical Stability of Intercellular Adhesions.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21269460 2011 Initial characterization of the human central proteome.
20953187 2010 Association analyses identify six new psoriasis susceptibility loci in the Chinese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19188865 2009 Serine protease inhibitor 8 is a novel immunohistochemical marker for neuroendocrine tumors of the pancreas.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
More...