Property Summary

NCBI Gene PubMed Count 71
Grant Count 23
R01 Count 17
Funding $1,166,405.88
PubMed Score 203.17
PubTator Score 208.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -3.000 0.000
osteosarcoma -3.587 0.000
group 4 medulloblastoma -1.700 0.000
astrocytoma 1.200 0.006
medulloblastoma, large-cell -1.900 0.000
colon cancer -2.400 0.012
ulcerative colitis -1.500 0.000
ovarian cancer -1.100 0.000

Gene RIF (58)

PMID Text
26808626 Methylation at 2 CpG sites in CPT1A on chromosome 11 was significantly associated with MetS. Significant associations were replicated in both European and African ancestry participants.
26716645 High CPT1A expression is associated with ovarian cancer.
26276667 Targeting the leukemia cell metabolism by the CPT1a inhibition
26110892 This large-scale epigenome-wide study discovered and replicated robust associations between DNA methylation at CpG loci and obesity indices
26041663 CPT1 is active on the outer surface of mitochondria and serves as a regulatory site for fatty acid oxidation due to its sensitivity for malonyl-CoA. CPT1a is the hepatic isoform.
25501281 The present study was designed to evaluate the involvement of hexokinase and CPT-1 in the cell growth and proliferation of human prostate cancer cell lines, PC3, and LNCaP-FGC-10.
25183267 CPT1A inhibition with RNAi resulted in triglyceride accumulation in HepG2 cells. The CPT1A promoter region was determined to contain two putative Sp1 binding sites, namely Sp1a and Sp1b, which might act as the GBE regulation response DNA element.
24920721 CPT1A methylation was strongly associated with fasting very-low low-density lipoprotein cholesterol and trigylcerides.
24618825 High grade glioblastoma is associated with increased level of ZFP57, a protein involved in gene imprinting, and aberrant expression of CPT1A and CPT1C.
24118240 The results suggest the generality of carnitine palmitoyltransferase-1 inhibition under various stress conditions associated with ROS generation, providing an insight into a mechanism for oxidative dysfunction in mitochondrial metabolism.
More...

AA Sequence

MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVM      1 - 70
TTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEH     71 - 140
GKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFA    141 - 210
VGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAIL    211 - 280
LYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHD    281 - 350
GRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL    351 - 420
DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMS    421 - 490
IDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIK    491 - 560
KCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRL    561 - 630
KLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLE    631 - 700
NNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSN    701 - 770
SKK                                                                       771 - 773
//

Text Mined References (73)

PMID Year Title
26808626 2016 Association of DNA Methylation at CPT1A Locus with Metabolic Syndrome in the Genetics of Lipid Lowering Drugs and Diet Network (GOLDN) Study.
26716645 2016 Carnitine palmitoyltransferase 1A functions to repress FoxO transcription factors to allow cell cycle progression in ovarian cancer.
26276667 2015 Targeting the leukemia cell metabolism by the CPT1a inhibition: functional preclinical effects in leukemias.
26110892 2015 Epigenome-wide study identifies novel methylation loci associated with body mass index and waist circumference.
26041663 2015 The Carnitine Palmitoyl Transferase (CPT) System and Possible Relevance for Neuropsychiatric and Neurological Conditions.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501281 2015 Targeting prostate cancer cell metabolism: impact of hexokinase and CPT-1 enzymes.
25183267 2014 Flavonoid ingredients of Ginkgo biloba leaf extract regulate lipid metabolism through Sp1-mediated carnitine palmitoyltranferase 1A up-regulation.
24920721 2014 Epigenome-wide association study of fasting blood lipids in the Genetics of Lipid-lowering Drugs and Diet Network study.
24618825 2014 High grade glioblastoma is associated with aberrant expression of ZFP57, a protein involved in gene imprinting, and of CPT1A and CPT1C that regulate fatty acid metabolism.
More...