Property Summary

NCBI Gene PubMed Count 72
Grant Count 2
Funding $126,933.34
PubMed Score 203.77
PubTator Score 99.93

Knowledge Summary

Patent (25,376)

Expression

Synonym

Accession P50406 Q13640 Q5TGZ1 5-HT-6
Symbols 5-HT6
5-HT6R

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (64)

PMID Text
26449188 Serotonin 6 receptor has a role in Alzheimer's disease and depression
25034463 that HTR6 plays an important role in modulating seizure activity and that the blockade of the 5-HT6 receptor/mTOR pathway could be a potential therapeutic target for epilepsy treatment
24850589 Studies indicate that serotonin 5-HT6 receptor (5-HT6R) has been proposed as a promising drug target for cognition enhancement in Alzheimer's disease (AD).
23844689 [review] Controlling the activity of 5-HTR6 receptors seems to provide benefits by alleviating cognitive impairments.
23542166 Data indicate that hydrogen-bond formation of a methoxy or hydroxy group is not important for binding at the 5-HT6 receptor.
23027611 These observations suggest that recruitment of mTOR by prefrontal 5-HT(6) receptors contributes to the perturbed cognition in schizophrenia, offering new vistas for its therapeutic control.
22833193 When expressed in pyramidal neuron progenitors, serotonin receptor 5-HT6 transgene decreases the migration speed of cortical pyramidal neurons, thereby affecting a fundamental step in the assembly of neural circuits.
22745941 results indicate that tagging SNPs in HTR6 may not play a role in the pathophysiology of schizophrenia.
22278721 present findings showed the presence of a higher density of 5-HT(6) receptors, as labeled by [(125)I]SB-258585, in striatum than in hippocampus and prefrontal cortex, and specifically within the neuronal body
21728060 There was a statistically significant difference in semantic memory scores among the three genotype groups of T267C in 5-HT6.
More...

AA Sequence

MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNTSNFFLVSLFT      1 - 70
SDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTP     71 - 140
LRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQCRLLASLPFVLVASGLTFFLPSGAICFTYCR    141 - 210
ILLAARKQAVQVASLTTGMASQASETLQVPRTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVT    211 - 280
WLPFFVANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLAS    281 - 350
PSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF    351 - 420
FNIDPAEPELRPHPLGIPTN                                                      421 - 440
//

Text Mined References (73)

PMID Year Title
26449188 2015 Serotonin 6 receptor controls Alzheimer's disease and depression.
25034463 2015 5-HT6 Receptor Recruitment of mTOR Modulates Seizure Activity in Epilepsy.
24850589 2014 Serotonin 5-HT6 receptor antagonists for the treatment of cognitive deficiency in Alzheimer's disease.
23844689 2013 Improving the treatment of schizophrenia: role of 5-HT receptors in modulating cognitive and extrapyramidal motor functions.
23542166 2013 Structure-activity relationship of 5-chloro-2-methyl-3-(1,2,3,6-tetrahydropyridin-4-yl)-1H-indole analogues as 5-HT(6) receptor agonists.
23027611 2012 5-HT(6) receptor recruitment of mTOR as a mechanism for perturbed cognition in schizophrenia.
22833193 2011 Excess of serotonin affects neocortical pyramidal neuron migration.
22745941 2012 Serotonin 6 receptor gene and schizophrenia: case-control study and meta-analysis.
22278721 2012 Distribution of serotonin receptor of type 6 (5-HT?) in human brain post-mortem. A pharmacology, autoradiography and immunohistochemistry study.
21829518 2011 Serotonin receptor expression in human prefrontal cortex: balancing excitation and inhibition across postnatal development.
More...