Property Summary

NCBI Gene PubMed Count 25
PubMed Score 26.04
PubTator Score 19.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 3.31161212433349E-8
acute quadriplegic myopathy 1157 2.03215021353381E-6
malignant mesothelioma 3163 4.15300371168536E-6
medulloblastoma, large-cell 6234 3.84354744504447E-5
Waldenstrons macroglobulinemia 765 9.02939433301156E-5
sonic hedgehog group medulloblastoma 1482 1.2005079295573E-4
Multiple myeloma 1328 1.65516542753105E-4
ovarian cancer 8492 4.58733997613212E-4
diabetes mellitus 1663 0.00110107034418028
osteosarcoma 7933 0.0014357449860183
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0153499772834219
glioblastoma multiforme 347 0.0154320445481194
breast carcinoma 1614 0.0349652047997331
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0451053823069071
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0

Expression

Synonym

Accession P50395 O43928 Q5SX88 Q9UQM6 Rab GDI beta
Symbols RABGDIB
HEL-S-46e

Gene

PANTHER Protein Class (2)

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
17507299 The increased levels of cyclin I and GDI2 found to be associated with pancreatic carcinoma were further confirmed by Western blot analyses in an independent series of serum samples and/or pancreatic juice samples
16385451 Observational study of gene-disease association. (HuGE Navigator)
11771757 Reduction of nucleoside diphosphate kinase B, Rab GDP-dissociation inhibitor beta and histidine triad nucleotide-binding protein in fetal Down syndrome brain.

AA Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR      1 - 70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF     71 - 140
RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK    141 - 210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL    211 - 280
ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI    281 - 350
AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI    351 - 420
YKRMTGSEFDFEEMKRKKNDIYGED                                                 421 - 445
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23727862 2013 Genome-wide association study identifies two susceptibility loci for osteosarcoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...