Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.54
PubTator Score 19.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.173 2.8e-07
breast carcinoma 1.100 3.5e-02
diabetes mellitus 1.800 1.1e-03
glioblastoma multiforme -1.300 1.5e-02
group 3 medulloblastoma 1.200 4.3e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.5e-02
lung adenocarcinoma 1.314 3.3e-08
malignant mesothelioma -1.100 4.2e-06
medulloblastoma, large-cell 1.600 3.8e-05
Multiple myeloma 1.355 1.7e-04
osteosarcoma -1.058 1.4e-03
ovarian cancer -1.100 4.6e-04
pancreatic ductal adenocarcinoma liver m... -2.140 4.5e-02
Waldenstrons macroglobulinemia 1.704 9.0e-05

Protein-protein Interaction (3)

Gene RIF (3)

AA Sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR      1 - 70
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF     71 - 140
RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK    141 - 210
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL    211 - 280
ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI    281 - 350
AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI    351 - 420
YKRMTGSEFDFEEMKRKKNDIYGED                                                 421 - 445
//

Text Mined References (36)

PMID Year Title