Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
Funding $55,481.11
PubMed Score 4.67
PubTator Score 156.66

Knowledge Summary

Patent (70,782)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 0.000

Synonym

Accession P50391 Q13456 Q5ISU3 Q5T2X9 Q6FH06 NPY4-R
Symbols Y4
PP1
PPYR1
NPY4-R

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

2IK5  

  TechDev Info (1)

Gene RIF (10)

PMID Text
26575790 Data suggest that repression of JNK-c-Jun signaling through pancreatic polypeptide receptor 1 (PP1) is one of the key anti-tumor mechanisms of neuronal membrane cytoskeletal protein 4.1 (4.1N).
25445712 These data demonstrate glucose-regulated secretion of PP and its effects on glucagon release through PPYR1 receptors expressed by alpha-cells.
24375409 Pancreatic polypeptide is recognized by two hydrophobic domains of the human Y4 receptor binding pocket.
22947943 structure determination of transmembrane segments of Y4 and the yeast Ste2p G-protein-coupled receptors
21745157 Results report on the functional reconstitution of the hY(2)R and the hY(4)R in Sf9 insect cells using the baculovirus system.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19481128 Results suggest that rabbit and human Y1, Y2 and Y5 receptor subtypes are well conserved, whereas Y4 receptors are less well conserved.
19229253 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18826257 PP1 is targeted to DNA polymerase III via an interaction with the p68 subunit.
11906964 The pharmacologic insensitivity of pancreatic polypeptide responses to either NPY1- or NPY2-receptor antagonism, or to tetrodotoxin, indicates that NPY4 receptors are involved and that they are predominantly post-junctional in colon mucosa.

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQK      1 - 70
EKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERH     71 - 140
QLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHH    141 - 210
RTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLP    211 - 280
LHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESE    281 - 350
HLPLSTVHTEVSKGSLRLSGRSNPI                                                 351 - 375
//

Text Mined References (24)

PMID Year Title
26575790 2016 Protein 4.1N acts as a potential tumor suppressor linking PP1 to JNK-c-Jun pathway regulation in NSCLC.
25445712 2015 Pancreatic polypeptide regulates glucagon release through PPYR1 receptors expressed in mouse and human alpha-cells.
24375409 2014 Pancreatic polypeptide is recognized by two hydrophobic domains of the human Y4 receptor binding pocket.
22947943 2012 Comparison of fragments comprising the first two helices of the human Y4 and the yeast Ste2p G-protein-coupled receptors.
21745157 2011 Functional reconstitution of human neuropeptide Y (NPY) Y(2) and Y(4) receptors in Sf9 insect cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19481128 2009 Cloning and characterization of rabbit neuropeptide Y receptor subtypes.
19229253 2009 Genome-wide association study suggested copy number variation may be associated with body mass index in the Chinese population.
18826257 2008 Protein phosphatase-1 is targeted to DNA polymerase delta via an interaction with the p68 subunit.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
More...