Property Summary

Ligand Count 20
NCBI Gene PubMed Count 25
PubMed Score 4.59
PubTator Score 156.66

Knowledge Summary

Patent (70,782)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.0e-20
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 3.0e-20

Gene RIF (12)

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQK      1 - 70
EKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERH     71 - 140
QLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHH    141 - 210
RTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLP    211 - 280
LHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESE    281 - 350
HLPLSTVHTEVSKGSLRLSGRSNPI                                                 351 - 375
//

Text Mined References (26)

PMID Year Title