Property Summary

Ligand Count 22
NCBI Gene PubMed Count 45
PubMed Score 296.78
PubTator Score 860.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 3.5e-03
ependymoma 1.100 4.7e-05
group 3 medulloblastoma 1.100 2.0e-03
lung cancer 1.500 3.1e-03
malignant mesothelioma -1.300 1.1e-05
nasopharyngeal carcinoma -1.100 1.3e-05
osteosarcoma -3.752 1.4e-08
pancreatic cancer 1.100 3.9e-02
pancreatic carcinoma 1.100 3.9e-02
primitive neuroectodermal tumor 1.300 3.1e-02
psoriasis -1.300 2.9e-10
tuberculosis 1.400 1.5e-06

Gene RIF (19)

AA Sequence

MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGAR      1 - 70
TLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGK     71 - 140
EPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLGLLLGAGRTPQ    141 - 210
PDSALIRQALAERWSQWSLRGGLEMLPQALETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEAD    211 - 280
HVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS    281 - 350
VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP    351 - 420
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS                 421 - 477
//

Text Mined References (63)

PMID Year Title