Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.30
PubTator Score 33.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
psoriasis 6685 4.06728270130601E-8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession P50238 H3BPI2 Q13628 Q53XY7 Q96J34 CRP-1
Symbols CRHP
CRIP
CRP1
CRP-1

Gene

  Ortholog (7)

Species Source
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
26708131 This study provides evidence for a prognostic clinical potential of the combined study of GAL-3 and CRIP-1 in endometrial cancer
22202598 CRIP1 expression is associated with long-term survival and no metastases in osteosarcoma patients.

AA Sequence

MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG      1 - 70
AESHTFK                                                                    71 - 77
//

Text Mined References (19)

PMID Year Title
26708131 2016 Co-expression of galectin-3 and CRIP-1 in endometrial cancer: prognostic value and patient survival.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22202598 2011 CRIP1 expression is correlated with a favorable outcome and less metastases in osteosarcoma patients.
21269460 2011 Initial characterization of the human central proteome.
20415737 2010 Ultraviolet B radiation regulates cysteine-rich protein 1 in human keratinocytes.
20108983 2010 DNA bending by the mammalian high-mobility group protein AT hook 2.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18670594 2008 Identification and rational redesign of peptide ligands to CRIP1, a novel biomarker for cancers.
17486081 2007 Hypomethylation of WNT5A, CRIP1 and S100P in prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...