Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.30
PubTator Score 33.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.1e-08

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 4.1e-08

Gene RIF (5)

AA Sequence

MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG      1 - 70
AESHTFK                                                                    71 - 77
//

Text Mined References (22)

PMID Year Title