Property Summary

NCBI Gene PubMed Count 15
Grant Count 31
R01 Count 16
Funding $2,145,841.25
PubMed Score 7.30
PubTator Score 33.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Peripheral Neuropathy 303
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Gene RIF (2)

PMID Text
26708131 This study provides evidence for a prognostic clinical potential of the combined study of GAL-3 and CRIP-1 in endometrial cancer
22202598 CRIP1 expression is associated with long-term survival and no metastases in osteosarcoma patients.

AA Sequence

MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG      1 - 70
AESHTFK                                                                    71 - 77
//

Text Mined References (19)

PMID Year Title
26708131 2016 Co-expression of galectin-3 and CRIP-1 in endometrial cancer: prognostic value and patient survival.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22202598 2011 CRIP1 expression is correlated with a favorable outcome and less metastases in osteosarcoma patients.
21269460 2011 Initial characterization of the human central proteome.
20415737 2010 Ultraviolet B radiation regulates cysteine-rich protein 1 in human keratinocytes.
20108983 2010 DNA bending by the mammalian high-mobility group protein AT hook 2.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18670594 2008 Identification and rational redesign of peptide ligands to CRIP1, a novel biomarker for cancers.
17486081 2007 Hypomethylation of WNT5A, CRIP1 and S100P in prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...