Property Summary

NCBI Gene PubMed Count 41
PubMed Score 67.37
PubTator Score 46.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 1.3e-06
Barrett's esophagus 1.100 4.4e-02
esophageal adenocarcinoma 1.100 2.5e-02
glioblastoma -1.300 2.7e-05
lung adenocarcinoma -1.100 1.0e-13
lung carcinoma -1.200 8.1e-12
malignant mesothelioma 2.800 1.6e-07
medulloblastoma, large-cell -1.600 4.5e-06
non-small cell lung cancer -1.485 6.1e-20
osteosarcoma -1.764 7.7e-05
ovarian cancer -1.300 1.8e-06
pediatric high grade glioma -1.100 4.8e-05
primitive neuroectodermal tumor -1.300 1.1e-04
tuberculosis 1.400 1.1e-05
ulcerative colitis -1.400 2.7e-05

Protein-protein Interaction (3)

Gene RIF (23)

AA Sequence

MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
HRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY     71 - 140
HFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AKKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (43)

PMID Year Title