Property Summary

NCBI Gene PubMed Count 39
Grant Count 14
R01 Count 11
Funding $2,217,879.2
PubMed Score 67.44
PubTator Score 46.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
Barrett's esophagus 1.100 0.044
esophageal adenocarcinoma 1.100 0.025
osteosarcoma -1.764 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.300 0.000
tuberculosis 1.400 0.000
non-small cell lung cancer -1.485 0.000
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma -1.100 0.000
lung carcinoma -1.200 0.000
ulcerative colitis -1.400 0.000
ovarian cancer -1.300 0.000

Gene RIF (22)

PMID Text
26169578 It metabolizes breast cancer drugs like afimoxifene and endoxifen by sulfation.
23922954 SULT1A2 genotype also seems to play an important role in maintaining optimal levels of both 4OH-TAM and endoxifen.
23358261 resequenced the SULT1A2 and SULT1A2 genes and identified 51 variations in ethnic Koreans, including 9 that were previously unknown. Allele frequencies, haplotype structures, LD blocks, and haplotype-tagging SNPs were determined.
20936502 the statistical hypothesis that SULT1A1 and SULT1A2 alleles are independently distributed was rejected; a strongly positive linkage was detected between SULT1A1*2 and SULT1A2*2 alleles in Turkey population
20936502 Observational study of genotype prevalence. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20417180 the structures of SULT1A2 and an allozyme of SULT1A1, SULT1A1 *3, bound with 3'-phosphoadenosine 5'-phosphate at 2.4 and 2.3A resolution, respectively, were determined.
20214802 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
HRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY     71 - 140
HFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AKKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (41)

PMID Year Title
26169578 2015 Sulfation of afimoxifene, endoxifen, raloxifene, and fulvestrant by the human cytosolic sulfotransferases (SULTs): A systematic analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23922954 2013 Relationship between genotypes Sult1a2 and Cyp2d6 and tamoxifen metabolism in breast cancer patients.
23358261 2013 Single nucleotide polymorphisms in SULT1A1 and SULT1A2 in a Korean population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20936502 2010 Genetic polymorphisms of sulfotransferases (SULT1A1 and SULT1A2) in a Turkish population.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20417180 2010 Crystal structures of SULT1A2 and SULT1A1 *3: insights into the substrate inhibition and the role of Tyr149 in SULT1A2.
More...