Property Summary

NCBI Gene PubMed Count 203
Grant Count 125
R01 Count 82
Funding $20,112,929.03
PubMed Score 330.92
PubTator Score 679.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
primitive neuroectodermal tumor -1.300 0.001
ovarian cancer -1.100 0.001

Synonym

Accession P50225 Q2NL71 Q86U58 Q92818 Q9BVU6 Q9UGG7 ST1A1
Symbols PST
STP
STP1
P-PST
ST1A1
ST1A3
TSPST1
HAST1/HAST2

Gene

PANTHER Protein Class (1)

PDB

1LS6   1Z28   2D06   3QVU   3QVV   3U3J   3U3K   3U3M   3U3O   3U3R   4GRA  

Gene RIF (204)

PMID Text
26906565 Cytosolic sulfotransferase 1A1 regulates HIV-1 minus-strand DNA elongation in primary human monocyte-derived macrophages.
26340710 Sulfotransferase 1A1 Substrate Selectivity: A Molecular Clamp Mechanism.
26169578 It metabolizes breast cancer drugs like afimoxifene and endoxifen by sulfation.
26067475 A systematic analysis showed that three of the twelve human SULTs, SULT1A1, SULT1A3 and SULT1C4, displayed the strongest sulphating activity towards acetaminophen.
26022216 Higher SULT1A1 levels were observed in rats as well as in humans exposed to high altitude, when compared to sea-level controls
25819444 Data suggest that the substrate specificities of SULT1E1 and SULT1A1*1 include metabolites of tamoxifen (endoxifen, 4-hydroxytamoxifen, and N-desmethyltamoxifen); these metabolites are weak inhibitors of sulfation of estradiol by SULT1E1/SULT1A1*1.
25771868 Sulfo-conjugation of the multi-hydroxylated metabolites of benzene by human SULT1A1 may represent an important detoxifying pathway.
25654087 The aim of the study was to assess whether selected single nucleotide polymorphisms of CYP1A1 and 2E1, GSTM1, GSTT1, and SULT1A1 influence susceptibility towards hepatocellular carcinoma.
25385181 Results indicate that SULT1A1 Arg(213)His may act as a low-penetrance risk allele for developing MBC and could be associated with a specific tumor subtype associated with HER2 overexpression.
25370010 SULT1A1 is responsible for bioactivation of food genotoxicants 5-hydroxymethylfurfural and furfuryl alcohol.
More...

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
HRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY     71 - 140
HFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AEKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (209)

PMID Year Title
26906565 2016 Cytosolic sulfotransferase 1A1 regulates HIV-1 minus-strand DNA elongation in primary human monocyte-derived macrophages.
26340710 2015 Sulfotransferase 1A1 Substrate Selectivity: A Molecular Clamp Mechanism.
26169578 2015 Sulfation of afimoxifene, endoxifen, raloxifene, and fulvestrant by the human cytosolic sulfotransferases (SULTs): A systematic analysis.
26067475 2015 Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.
26022216 2015 The proteome of Hypobaric Induced Hypoxic Lung: Insights from Temporal Proteomic Profiling for Biomarker Discovery.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25819444 2015 The effects of endoxifen and other major metabolites of tamoxifen on the sulfation of estradiol catalyzed by human cytosolic sulfotransferases hSULT1E1 and hSULT1A1*1.
25771868 2014 Human CYP2E1-dependent and human sulfotransferase 1A1-modulated induction of micronuclei by benzene and its hydroxylated metabolites in Chinese hamster V79-derived cells.
25654087 2015 The effect of CYP, GST, and SULT polymorphisms and their interaction with smoking on the risk of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
More...